KEGG   Streptococcus pyogenes STAB901 (serotype M44): STAB901_07335Help
Entry
STAB901_07335     CDS       T03472                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
spyo  Streptococcus pyogenes STAB901 (serotype M44)
Pathway
spyo00220  Arginine biosynthesis
spyo00250  Alanine, aspartate and glutamate metabolism
spyo00290  Valine, leucine and isoleucine biosynthesis
spyo01100  Metabolic pathways
spyo01110  Biosynthesis of secondary metabolites
spyo01130  Biosynthesis of antibiotics
spyo01210  2-Oxocarboxylic acid metabolism
spyo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spyo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STAB901_07335
   00290 Valine, leucine and isoleucine biosynthesis
    STAB901_07335
   00220 Arginine biosynthesis
    STAB901_07335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spyo01007]
    STAB901_07335
Enzymes [BR:spyo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     STAB901_07335
    2.6.1.66  valine---pyruvate transaminase
     STAB901_07335
Amino acid related enzymes [BR:spyo01007]
 Aminotransferase (transaminase)
  Class I
   STAB901_07335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIG50759
LinkDB All DBs
Position
complement(1415315..1416529)
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAAFGFEAPDEVIRDLIV
NARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGVSELISISLQALLDNGD
EVLVPMPDYPLWTACVSLGGGKAVHYLCDEEAGWYPDIADIKSKITSRTKAIVVINPNNP
TGALYPKEILEDIVALAREHQLIIFADEIYDRLVMDGKEHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGHQSVDALL
LPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDRQMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVLYQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgaaaaatcatcaaaattagaacatgttgcctatgatattcgagggcct
gttttggatgaagctaatcgcatgattgcgagtggtgaaaaaattctgcgtttaaatact
ggcaatcctgctgcctttggttttgaagcaccagatgaagtgattcgtgatttaattgtc
aacgcgaggctaagtgagggctattctgacagtaaagggattttttcagcgcgtaaggct
atcatgcaatattgccaactcaagggcttcccagatgttgacattgaagatatttatttg
ggaaatggcgtgtcagagttgatatccatatcccttcaagctttgctagataatggcgat
gaagttttagtaccaatgccggattatcctttatggacggcttgtgtgagtcttggtgga
ggaaaagcggtccattatctttgtgatgaagaagctggttggtatcctgatattgctgat
atcaaatcaaaaatcacgagtcgcaccaaagctattgtggtcatcaatcctaataaccca
acaggagccctttatcctaaggagattttagaagacatcgttgctttggcaagagaacac
cagctgattatttttgccgacgaaatctatgatcgtttggtgatggatggtaaagagcat
attgctattgcaagtttggcacctgatgttttttgtgtatctatgaatggcctttccaaa
tctcatcgtattgctggttttcgtgttggatggatggtcttatcaggtcctaaagaccat
gttaaaggttacattgaagggttaaacatgcttgccaatatgcggttatgctccaatgtt
ttagcccaacaagttgttcaaacttccttaggaggccatcaatcagttgatgcactgtta
ctgccaggagggcgtatttttgagcaacgtaattttatttatgaagctattaatgctatc
cctggcttatcggcagttaaacctgaagcaggtctttatttatttccgaaaattgatcgt
cagatgtatcgtattgatgatgatgaagaatttgtcttacagttattaaagcaagaaaaa
gtgatgttggtacatggacgtggttttaactggaaagatccagatcacttccgtattgtt
tacctaccaagtgtagaagaattagaagatgtccaagaaaagattacacgtgtcttatac
cagtatagacgttaa

DBGET integrated database retrieval system