KEGG   Serratia quinivorans: E4343_03265
Entry
E4343_03265       CDS       T05941                                 

Gene name
rstB
Definition
(GenBank) two-component system sensor histidine kinase RstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
squ  Serratia quinivorans
Pathway
squ02020  Two-component system
Brite
KEGG Orthology (KO) [BR:squ00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    E4343_03265 (rstB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:squ01001]
    E4343_03265 (rstB)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:squ02022]
    E4343_03265 (rstB)
Enzymes [BR:squ01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     E4343_03265 (rstB)
Protein kinases [BR:squ01001]
 Histidine kinases
  OmpR family
   E4343_03265 (rstB)
Two-component system [BR:squ02022]
 OmpR family
  RstB-RstA
   E4343_03265 (rstB)
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 HATPase_c_3 HATPase_c_5
Other DBs
NCBI-ProteinID: QBX65255
LinkDB
Position
complement(697655..698959)
AA seq 434 aa
MRKLFVQFFLLLFVCFLVMAMLVGLVYKVTAERAGRQSMDDLMKSSLYLMRSELREIPLK
DWNKTIATLDLNLSFKLHIEPLGKQDLSEDLKKRLRLGEIIALDDQYTFMQRIPRSHYVL
VVGPIPYLFYLHQMRLLDLALLVFIGMSLALPVFLWMRPHWQDLLKLENAAQRLGAGHLD
ERTHFDPTSSLNRLGVAFNQMADNVNTLIASKKQLIDGIAHELRTPLVRLRYRLAMSDNL
SESEQQALNRDIGQLESLIDELLTYARLDRPQVALNIEPLDLPKWLEDKADDLRLIHPER
EIELNIPHVGDFGGVDLRLMERVLDNLVNNALRYSEQRLRIGLWFDGDNACLQVEDDGPG
IPPEERERVFEPFVRLDPSRDRATGGCGLGLAIVHSIAVAYQGQVYVDASSLGGASFRFC
WPLKPTFNLKADPV
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgagaaagctctttgtgcagttcttcctgctgcttttcgtgtgtttcctggtgatggcg
atgctggtggggttggtgtacaaagtcaccgccgaacgcgccggccgccagtcgatggac
gatctgatgaaaagctcgctgtacctgatgcgcagcgaactgcgggaaattccgctcaaa
gactggaacaagaccatcgccacgctggacttgaatctgtcgtttaagctgcacatcgag
ccgctgggcaaacaggatctgagcgaagatttgaaaaaacggctgcgtctgggggagatt
atcgccctcgacgatcaatacacctttatgcagcgcatcccgcgcagtcactacgtgctg
gtggtcgggccgatcccttatctgttctatctgcatcaaatgcggctgctggatttggcg
ctgctggtgtttatcggcatgtcgctggcgctgccggtatttctgtggatgcgtccgcac
tggcaggacttgctgaagctcgaaaacgcggctcagcgcctcggtgccgggcatctggat
gagcgcacccatttcgaccctacctccagcctgaatcggcttggcgtagcctttaaccag
atggcggataacgtcaatacgctgatcgccagcaagaaacagctgatagacggtatcgcc
catgaactgcgcactccgctggtacggctgcgttaccgcctggcgatgagcgataacctt
tccgagagtgaacagcaggcgctgaaccgcgatatcggtcagttggagtcactgatcgac
gaactgctgacctatgcacgattggaccgtccgcaggtcgcactcaatatagaaccgctg
gatttgcccaaatggctggaggacaaggctgacgacctgcgcctgatccacccggaacgt
gaaatcgaattgaacatcccgcacgtcggtgattttggcggcgtcgatttacggctaatg
gagcgggtgctggataatctggtgaacaatgcgctgcgttatagtgagcaacgcttgcgc
atcggcctgtggtttgacggcgacaacgcttgcctgcaggtagaagacgatgggccaggt
attccgccggaagaacgtgagcgggtattcgagccctttgtacgtctcgatcccagccgc
gatcgcgctaccggcggctgtggcctgggtttggcgattgttcattcgattgccgtggcc
taccagggccaggtctacgttgacgccagctctctcggtggtgccagcttccgattctgt
tggccgctaaagcccactttcaatttaaaagcagacccggtgtaa

DBGET integrated database retrieval system