KEGG   Serratia quinivorans: E4343_04265Help
Entry
E4343_04265       CDS       T05941                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
squ  Serratia quinivorans
Pathway
squ00061  Fatty acid biosynthesis
squ00780  Biotin metabolism
squ01100  Metabolic pathways
squ01212  Fatty acid metabolism
Module
squ_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:squ00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    E4343_04265 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    E4343_04265 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:squ01004]
    E4343_04265 (fabZ)
Enzymes [BR:squ01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     E4343_04265 (fabZ)
Lipid biosynthesis proteins [BR:squ01004]
 Fatty acid synthase
  Component type
   E4343_04265 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA 4HBT
Motif
Other DBs
NCBI-ProteinID: QBX65435
LinkDB All DBs
Position
931915..932370
Genome map
AA seq 151 aa AA seqDB search
MPLNGKPLQFQDVQSILPHRFPCLLVDRILPDGTSVAEGRLSAIKNITANEPTFWTGHHQ
TTVFPGILMVEALAQTTGLLAHYFLSPLLPGEHYYFAAIHHARFYRSARPGDQLRMDVAF
VRQRSGLARFTGRATVNGRRICTAEFMCARK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcaatggtaaaccactacagtttcaggatgttcaatctatcctgccgcaccgc
ttcccctgtctgctggttgaccgcattctccctgacggcacctccgttgccgaaggccgc
ttaagtgccatcaaaaatatcactgccaacgaaccgaccttctggactggccaccaccag
accacggtgtttcccggcatattaatggtggaggcactggcacaaaccaccggcttgttg
gcgcattactttctcagcccgctattacccggcgaacattactattttgccgccattcat
cacgctcgcttctatcgctcggcccggcccggcgatcagcttcgcatggatgtcgccttt
gtccgacagcgctccggccttgcccgctttaccggtcgtgctacggtaaatggccgccgc
atctgtaccgccgagtttatgtgcgctcgtaagtag

DBGET integrated database retrieval system