KEGG   Serratia quinivorans: E4343_05060Help
Entry
E4343_05060       CDS       T05941                                 

Gene name
gstA
Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
squ  Serratia quinivorans
Pathway
squ00480  Glutathione metabolism
squ01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:squ00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    E4343_05060 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:squ02000]
    E4343_05060 (gstA)
Enzymes [BR:squ01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     E4343_05060 (gstA)
Transporters [BR:squ02000]
 Other transporters
  Pores ion channels [TC:1]
   E4343_05060 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3 GST_N_2 GST_C_2 Glutaredoxin2_C GST_C_6 GST_N_5 DUF4422
Motif
Other DBs
NCBI-ProteinID: QBX65587
LinkDB All DBs
Position
1107546..1108151
Genome map
AA seq 201 aa AA seqDB search
MKLFYKAGACSLSPHIVLREAGLDFTAEKVDLALKKTESGANYLTINPKGQVPALLLDDG
SLLTEGVAIVQYLADRVPDRALIPAAGTLSRYHAIEWLNYIATELHKGFSPLFNPKTPEE
YKTIAREKLDTQFDYLDSVLAKQHFLLGNKFSVADAYLFTILRWAIALQFDIKKRSQLSA
YFDRVAARPAVDATLNAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaagccggcgcctgttctctgtccccccatattgtattgcgcgaa
gcaggcctggacttcaccgcagaaaaggtcgatctggcgctgaaaaagaccgaaagcggt
gcgaactatctgaccatcaacccgaaaggacaggtcccggcgctgctgctggatgatggc
agcctgctgaccgaaggcgtggcaattgtgcaatatctggcggatcgcgtgccggatcgc
gctctgatccccgcagcaggtacgctgtcgcgttatcatgccattgaatggctgaactat
attgccactgagctgcacaaggggttcagtccgctgtttaacccgaaaacgcctgaagaa
tacaaaaccatcgcgcgggaaaaactggacacgcagtttgactatctggattcggtgctg
gcgaagcagcatttcctgttgggcaacaagttcagcgtggcggatgcctatttgttcacc
attctgcgctgggccatcgccctgcagtttgatatcaaaaagcgcagccagctttcggcc
tattttgatcgcgtggccgcgcgacctgcggtggacgcaacgttgaatgcggaaggcttg
aaataa

DBGET integrated database retrieval system