KEGG   Serratia quinivorans: E4343_05425Help
Entry
E4343_05425       CDS       T05941                                 

Definition
(GenBank) 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase
  KO
K13014  undecaprenyl phosphate-alpha-L-ara4FN deformylase [EC:3.5.1.-]
Organism
squ  Serratia quinivorans
Pathway
squ00520  Amino sugar and nucleotide sugar metabolism
squ01100  Metabolic pathways
squ01503  Cationic antimicrobial peptide (CAMP) resistance
Module
squ_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:squ00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    E4343_05425
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    E4343_05425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:squ01005]
    E4343_05425
Enzymes [BR:squ01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     E4343_05425
Lipopolysaccharide biosynthesis proteins [BR:squ01005]
 Unusual sugar
  E4343_05425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1 DUF2334
Motif
Other DBs
NCBI-ProteinID: QBX65653
LinkDB All DBs
Position
complement(1184762..1185667)
Genome map
AA seq 301 aa AA seqDB search
MKKVGLRVDVDTFSGTREGVPQLLELFEKYNIQASFFFSVGPDNMGRHLWRLLRPKFLWK
MLRSNAASLYGWDILLAGTAWPGRNIARALGPLMKLTAQAGHEVGLHAWDHQGWQAKVGR
WSEAQLMQQVQLGVDALANSTGQPVKCSAVAGWRADTRVLEVKQRFGFHYNSDCRGTHPF
RPVLSDGRLGTVQIPVTLPTFDEVIGSEVSMNDFNDYILRAIENDRGVPVYTIHTEVEGM
SQAAMFEQLLLRAQRQGIEFCPLSALLPQDLASLPLGRVERAPFPGREGWLGCQTDVKDD
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtcggtctgcgagttgacgtagataccttcagcggcacccgggaaggggtg
ccgcagttgctggagctgttcgaaaagtacaatattcaggccagtttcttcttcagcgtt
ggaccggacaatatggggcgccatttgtggcgccttttgcgtccgaaattcctgtggaaa
atgctgcgctccaatgccgcgtcactgtacggctgggatattttgctggcaggtacggcc
tggccggggcgtaatattgcccgtgccctggggccgttgatgaaactgactgcacaggct
gggcatgaagtggggctgcacgcctgggatcaccaggggtggcaggctaaagttggccgt
tggtcagaagcgcaactgatgcagcaggttcagctcggtgtggatgcgctggccaacagt
accggtcagcctgtcaaatgttcggcggttgccggttggcgtgccgatacgcgggtgctg
gaagtgaagcagcgttttggttttcactacaacagcgactgtcgtggcacccatcctttc
cgtccggtgttaagcgatggtcggttgggaaccgtacaaatcccggtcacgttgcccacc
tttgatgaggtgattggcagcgaagtgagtatgaatgatttcaacgattacattctgcgg
gcgattgaaaacgatcgcggtgtgccggtgtataccattcataccgaagtggagggcatg
tcacaggccgcaatgtttgagcagttactgctgcgggcgcaacggcagggcatagaattc
tgtccgttaagcgcactgttgcctcaagatttggcgtcattgccattgggccgcgtcgag
cgcgctcctttccctggccgtgaaggttggctgggttgtcaaaccgatgtgaaggacgat
tcatga

DBGET integrated database retrieval system