KEGG   Serratia quinivorans: E4343_08955Help
Entry
E4343_08955       CDS       T05941                                 

Definition
(GenBank) epimerase
Organism
squ  Serratia quinivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 Semialdhyde_dh Epimerase Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: QBX66311
LinkDB All DBs
Position
1946593..1947267
Genome map
AA seq 224 aa AA seqDB search
MKVIILGARGMVGQGALRECLRDPQVTEVLSIGRSALVQSHAKLRQLTLPDLSDLSAIEA
QLAGYDACFFCIGVSSAGMNEARYRTLTYDLTLAVARPLARLNPAMTFIYVSGVGTDSSE
RGRSMWARVKGATENALLALTFHAVMFRPGAIVPLHGIRSRTRLYDLLYRLFKPLWFGAL
RLFPQQVTTTERVGLAMLAVARHETALRIIEPAEINRLTLPSAG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcattatattgggcgcccgcggtatggttggccagggcgcgctgcgcgaatgc
ctgcgtgacccgcaggtaacggaagtcctcagcatcggccgcagcgcgctggtgcagagc
catgccaaattaagacagttgacgctgcccgacctgagtgacttatctgccatagaggca
cagcttgcaggttacgacgcctgctttttctgcattggcgtctcctcggccggcatgaac
gaagcgcgttaccgcaccctgacttacgacctgacgctggccgtcgcccgtccgcttgcg
cggctgaacccggcgatgacctttatttatgtttccggcgtcggcaccgacagcagcgaa
cgtggccgcagcatgtgggccagagtcaagggcgcaaccgagaacgccttgctggcactg
actttccacgccgtgatgttccgtcccggcgctatcgtgccgctgcacggcatccgctcc
agaacccggctgtatgatctgctgtatcggttatttaaaccgctgtggtttggcgcgctt
cggctgttcccccagcaggtcaccactaccgaacgcgtcgggctggcgatgctggcagta
gcacgccacgaaacggcgctgcggatcatcgaaccggcagagatcaatcgtctgacgctg
ccatcggcgggatga

DBGET integrated database retrieval system