KEGG   Serratia quinivorans: E4343_14955Help
Entry
E4343_14955       CDS       T05941                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex subunit alpha FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
squ  Serratia quinivorans
Pathway
squ00071  Fatty acid degradation
squ00280  Valine, leucine and isoleucine degradation
squ00281  Geraniol degradation
squ00310  Lysine degradation
squ00362  Benzoate degradation
squ00380  Tryptophan metabolism
squ00410  beta-Alanine metabolism
squ00640  Propanoate metabolism
squ00650  Butanoate metabolism
squ00903  Limonene and pinene degradation
squ00930  Caprolactam degradation
squ01100  Metabolic pathways
squ01110  Biosynthesis of secondary metabolites
squ01120  Microbial metabolism in diverse environments
squ01130  Biosynthesis of antibiotics
squ01200  Carbon metabolism
squ01212  Fatty acid metabolism
Module
squ_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:squ00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    E4343_14955 (fadB)
   00650 Butanoate metabolism
    E4343_14955 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    E4343_14955 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    E4343_14955 (fadB)
   00310 Lysine degradation
    E4343_14955 (fadB)
   00380 Tryptophan metabolism
    E4343_14955 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    E4343_14955 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    E4343_14955 (fadB)
   00281 Geraniol degradation
    E4343_14955 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    E4343_14955 (fadB)
   00930 Caprolactam degradation
    E4343_14955 (fadB)
Enzymes [BR:squ01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     E4343_14955 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     E4343_14955 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     E4343_14955 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     E4343_14955 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: QBX67386
LinkDB All DBs
Position
3180642..3182831
Genome map
AA seq 729 aa AA seqDB search
MLYQGETLQLHWLDNGIAELVFNAPGSVNKLDTRTVASLGEALAVLEKQTELKGLLLRST
KAAFIVGADITEFLSLFAAPAEKLQEWLNFANAIFNRLEDLPVPTISAINGYALGGGCEC
ILATDFRVASPDARIGLPETKLGIMPGFGGSVRLPRLLGNDSALEIIAAGKDVSAKDALK
VGLVDAVVAPEKLVEAALKMLQQAIEGKLDWRAYRQPKLEPLKLSPIEAAMSFTTAKGMV
MQTAGKHYPAPMTAVKTIEAAARLGRDEALKLETASFVPLARSKEARALVGIFLNDQFVK
GQAKKLAKGIEAPKQAAVLGAGIMGGGIAYQSALKGVPVVMKDISDKSLTLGMNEAAKLL
NKQLERGKLDGMKMAQVLSTIQPTLDYAGIERAQVIVEAVVENPKIKAAVLSEVEGLIGE
NTVLASNTSTIPINHLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEQTSDSTIAAVVAY
ASRMGKTPIVVNDCPGFFVNRVLFPYFAGFSMLLRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPERMGKDYRDAIDVMFDNQRFGQKNQLGFYRYSQDNKGKP
RKDNDEQTDVLLAEVSQPRQTISDEEIIARMMIPMINEVVRCLEENIIASPAEADMALVY
GIGFPPFHGGAFRYLDTLGTANYVELAQRYAHLGALYQVPAGLRAKAEHNESYYPVAAPL
SDVSTGQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgaaacattacaactgcactggctcgacaacggtatcgccgagctg
gtgttcaatgccccaggctcggtaaacaagctcgatacccgcaccgttgccagcctgggc
gaagcgctcgcggtgctggaaaagcagaccgagttaaaaggcctgctgctgcgttctacc
aaggccgcctttattgtcggcgccgacatcaccgaattcctttcgctgtttgctgccccg
gctgaaaagctgcaggagtggctgaacttcgccaatgcgatctttaaccggctggaagat
ctgccggtgccgaccatttcggccattaacggctatgcgctcggcggcggctgcgaatgt
attctggcgaccgacttccgcgttgcgtctccggatgcgcgtatcggcctgccggaaacc
aaactgggtattatgccgggcttcggcggctccgttcgcttgccacgccttttgggtaac
gacagcgcactggaaattattgccgccggtaaggacgtcagtgccaaagatgcactgaag
gtcggcctggtggatgcggtcgtcgcaccagaaaaattggtggaagccgcgctgaaaatg
ctgcaacaggcgattgagggcaagctggactggcgcgcctatcgccagccaaagctcgag
ccgttgaaactcagcccaatcgaagcggccatgagcttcaccaccgccaaaggcatggtg
atgcaaaccgctggcaaacattatccggcgccgatgaccgcggtcaaaaccattgaggcc
gccgccaggctgggccgtgatgaagcactgaaactggaaaccgccagctttgtgccattg
gcccgctccaaagaggcgcgcgcgctggtcggcatcttcctcaatgaccagtttgtgaaa
ggccaggcgaagaagctggcgaagggtattgaagcaccgaagcaggctgcggtgttgggc
gccggtatcatgggtggcggtatcgcctaccagtccgcgctgaaaggcgtgccggttgtc
atgaaagacatcagcgacaaatccctgacgctcggtatgaatgaagccgccaaactgctg
aacaagcagttggaacgcggcaagctcgatggcatgaagatggcccaggtgctatcgacc
attcaaccgacgctggattacgccggtatcgaacgcgcgcaggtgatcgtcgaagccgtg
gtcgagaatccaaagattaaggcggcagtattgtccgaagtggaaggcctgatcggtgaa
aataccgtactggcgtccaatacctcgaccattccgattaatcacctggcgaaatcgctg
aagcgcccacagaacttctgcggcatgcacttctttaatccggtacaccgcatgccactg
gtggaaattatccgcggcgagcagaccagcgacagcactatcgcggccgtggtggcctat
gccagccgcatgggtaaaacgccgattgtggttaacgattgcccagggttcttcgtcaac
cgtgtactgttcccgtattttgccggtttcagcatgctgctgcgcgacggggcggacttc
cgccagatcgacaaagtgatggaaaaacagtttggctggccaatgggcccggcttatctg
ctcgacgtcgtggggattgataccgcgcaccacgcccaggcggtgatggcggccggtttc
ccggaacgtatgggtaaagattaccgcgacgccatcgacgtgatgttcgataaccagcgt
tttggtcagaaaaaccagttgggcttctatcgttacagccaggacaacaaaggcaagccg
cgtaaagacaacgatgagcagaccgatgtgctgctggccgaagtcagccaaccgcgtcag
accatcagcgacgaagaaattatcgcccgcatgatgatcccgatgattaacgaagtggtg
cgctgtctggaagaaaacattattgccagcccggccgaagccgatatggcgctggtctac
ggcatcggtttccctccgttccacggcggggcgttccgttacctggatacgcttggtacc
gccaattatgtcgaactggcccagcgttatgcgcatctcggtgctttgtatcaggtgcct
gccggcctgcgcgccaaagctgaacataatgaaagctactacccggtggcagcgccgctg
tccgatgtctccactggccaaccggcatga

DBGET integrated database retrieval system