KEGG   Serratia quinivorans: E4343_15650Help
Entry
E4343_15650       CDS       T05941                                 

Definition
(GenBank) MarR family transcriptional regulator
Organism
squ  Serratia quinivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HxlR Penicillinase_R PadR HTH_34 TFIIE_alpha Fe_dep_repress TrmB HTH_20
Motif
Other DBs
NCBI-ProteinID: QBX67513
LinkDB All DBs
Position
complement(3332416..3332880)
Genome map
AA seq 154 aa AA seqDB search
MKIENTEQPATKNLLLLDQQLCFALYSANLALNKVYRKLLSQLELTYPQYLVMLVLWERD
EIRVTDIGERLFLDSATLTPLLKRLETAGLLARYRATTDERQVIIALTDAGRALREKAQS
VPEAVMCATDCSLDEIVNIKQQLEKLRGKLINQL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgaaaacaccgaacaacccgcgacgaaaaacctgctgctgctcgaccagcaa
ctttgctttgccctgtactccgccaacctggcgctgaataaggtgtatcgcaaactgctg
agccagcttgaactcacctacccgcaatacctggtgatgctggtgctgtgggagcgggac
gaaatcagggtcactgacattggcgaacggctatttctcgattccgccaccctgacgcca
ttgctgaaacgcctggagaccgccggtttgttagcgcgttaccgcgccaccaccgatgag
cggcaggtgattattgcgttaaccgatgccggtcgtgcgctgcgtgaaaaagcgcagtcg
gtgccggaagccgttatgtgcgctaccgattgcagcctcgatgaaatcgtcaatatcaaa
cagcagttggaaaagctgcgtggcaagctaatcaaccagctttga

DBGET integrated database retrieval system