KEGG   Serratia quinivorans: E4343_21815
Entry
E4343_21815       CDS       T05941                                 

Definition
(GenBank) LysR family transcriptional regulator
Organism
squ  Serratia quinivorans
SSDB
Motif
Pfam: LysR_substrate HTH_1
Other DBs
NCBI-ProteinID: QBX68639
LinkDB
Position
complement(4658070..4658963)
AA seq 297 aa
MDRIDAMRLFTRVVEQRSFTQAAQDLALPRSTVTDAIKQLEARLQVRLLQRTTRHVSPTL
DGEAYYQRCLTILADIEDAEMAFAGAKPRGLLRIDVHGTLARHFLLPGLPDFLAQYPDIE
LFMSEGDRLVDPVREGIDCVIRVGKLKDSDMVSRRLGELEEVTCAAPDYLQRFGTPLGID
ELEGHRMVGFRSSASGSIMPLEFNVAGRPQQLILPCTVSVSAAESLVTAARMGLGIIQVP
RYHLRDDLASGSLLPLLPQFPSTPMPVSLLYPRSRQLSPRVRVFIDWFSKVFAAGNH
NT seq 894 nt   +upstreamnt  +downstreamnt
atggacagaattgatgccatgcgtctgttcacccgcgtggtggaacaacgcagctttacc
caggccgcgcaggatctggctctgccacgttcgacggtgaccgatgccatcaaacaactg
gaggccaggttgcaggtgcggctgctacagcgcaccactcgccacgtcagcccaacgctg
gatggcgaggcttactatcagcgctgcctgactattctggcggatatcgaagatgccgag
atggcctttgccggtgcaaaaccgcgtggcttgttgcgcattgatgtgcatggcacgctg
gcacggcactttctgctgccggggttgcccgactttctggcgcaatatccggatatcgaa
ttgtttatgagcgaaggcgatcggctggtggatccggtgcgggaaggcatcgactgcgtg
atccgcgtaggtaaactgaaagacagcgatatggtgtcgcgtcggctgggtgagctggaa
gaagtgacctgcgcggcaccggactatctgcaacgcttcggcacaccgcttggcatcgat
gaacttgaagggcaccgcatggtgggttttcgctcctcggccagcggcagcataatgcca
ttggagtttaacgtcgcaggccggccgcagcagctaatattgccctgcacggtgtcggtc
agcgcggcggaaagcctggtgactgcggctcgtatggggttggggattattcaggtgccg
cgctatcacctgcgcgacgatttggccagcggcagtctgctgccgctgttaccacaattc
ccttccacgccaatgccggtatcgctgttgtatccccgcagccgccaactttcaccccgg
gtacgggtatttatcgactggttcagcaaggtgttcgccgcaggcaaccactaa

DBGET integrated database retrieval system