KEGG   Serratia sp. AS13: SerAS13_0040Help
Entry
SerAS13_0040      CDS       T02012                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sra  Serratia sp. AS13
Brite
Enzymes [BR:sra01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SerAS13_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEG25865
LinkDB All DBs
Position
complement(45275..45895)
Genome map
AA seq 206 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELASLSVEELIQD
LDKVPADKRTFMRNNAGGHANHSLFWKGLKIGTTLGGDLKAAIERDFGSVEKFQEEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAVAGASGFPIVGLDVWEHAYYLKYQN
KRPDYIKAFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatccctgccgtacgcctacgacgcactggaaccgcatttcgac
aagcagacgatggaaatccatcacaccaaacaccaccagacttacgtcaacaacgcgaac
accgtgctggaagcgtaccctgagctggcttcgctgagcgttgaagagctgatccaggat
ctggataaagtgccagccgacaagcgcactttcatgcgtaacaacgccggcggccacgct
aaccacagcctgttctggaaaggcctgaaaatcggcaccacgctgggtggcgatttgaaa
gccgctatcgaacgcgatttcggcagcgtcgagaaattccaggaagagttcgagaaagcc
gcagcaacccgcttcggttcaggttgggcctggctggtgctgaaaggcgacaaactggcc
gtggtatctaccgctaaccaggacagcccgctgatgggcgaagccgttgccggcgcttca
ggtttcccaatcgtgggcctggacgtgtgggaacacgcttactacctgaaatatcagaac
aaacgcccagactacatcaaagcgttctggaacgtggttaactgggacgaagcggcagca
cgcttcgctgcgaagaagtaa

DBGET integrated database retrieval system