KEGG   Serratia sp. AS13: SerAS13_1237Help
Entry
SerAS13_1237      CDS       T02012                                 

Definition
(GenBank) succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sra  Serratia sp. AS13
Pathway
sra00020  Citrate cycle (TCA cycle)
sra00190  Oxidative phosphorylation
sra00650  Butanoate metabolism
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
sra01120  Microbial metabolism in diverse environments
sra01130  Biosynthesis of antibiotics
sra01200  Carbon metabolism
Module
sra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sra_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SerAS13_1237
   00650 Butanoate metabolism
    SerAS13_1237
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SerAS13_1237
Enzymes [BR:sra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SerAS13_1237
    1.3.5.4  fumarate reductase (quinol)
     SerAS13_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C BEX
Motif
Other DBs
NCBI-ProteinID: AEG27034
LinkDB All DBs
Position
1352418..1354127
Genome map
AA seq 569 aa AA seqDB search
MRAALQISQAGSTCALISKVFPTRSHTVSAQGGITVALGNNHEDNWEWHMYDTVKGSDYI
GDQDAIEYMCKTGPEAVLELEHMGLPFSRTDEGRIYQRPFGGQSLNFGGEQAARTAAAAD
RTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGTTAICIETGEVVYFKAKATV
LATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRG
EGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREGRGCDGPWGPHVKLKLDHLG
KDVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGIPTKVTGQALTVNEKGEDVV
IPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGMHLQESLAEQGESRDASESDVDA
SLERLNRWNNTRSGEDPVEIRKALQACMQHNFSVFREGDAMAKGLEELKEIRERLKNARL
DDTSSEFNTQRIECLELDNLMETAFSTAVSANFRTESRGAHSRFDFPERDDANWLCHSLY
QPQSESMTRREVNMQPKLRPAFPPKVRSY
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcggcactgcagatttctcaagcggggtccacatgcgccctgatatccaaagta
tttccgacccgttcccataccgtgtctgcgcagggcggcattaccgtagccctgggtaat
aaccacgaagataactgggaatggcatatgtatgacacggtgaaaggctccgattatatc
ggtgaccaggacgccatcgaatatatgtgtaaaaccggcccggaagcggttctggagctg
gagcacatggggctgccgttctcccgtacggatgaaggccgcatctatcagcgcccgttc
ggcggccagtcgctgaactttggtggcgagcaggcggcacgcactgcggcggcggccgac
cgtaccggtcacgccctgttgcacaccctgtatcaacagaatctgaaaaaccataccacc
attttctccgagtggtatgcgctggatctggtgaaaaaccaggatggcgcggtggtgggc
accacggctatctgtatcgaaaccggtgaagtcgtgtacttcaaagccaaagctaccgtg
ctggcgaccggcggtgcaggccgtatttaccagtccaccaccaacgcacacatcaacacc
ggtgacggtgtcggcatggcgctgcgtgccggcgtgccggtgcaggacatggaaatgtgg
cagttccacccgaccggcatcgccggcgctggggtattggtgactgaaggttgtcgtggt
gaaggcggttacctgctgaacaaacacggcgagcgtttcatggagcgctacgcgccgaac
gccaaagatctggcgggccgtgatgtggtcgcccgttcgatcatgattgaaatccgtgaa
ggccgcggctgtgacggtccgtggggtccacacgtcaagctgaagctggatcacctgggt
aaagacgtactggaatcccgcctgccgggcattctggaactgtcgcgcactttcgcacac
gtcgatccggtgaaagagccgatcccggtgatcccgacctgccactacatgatgggcggc
attccgaccaaggtgaccggccaggcactgaccgtgaacgagaaaggcgaagatgtggtg
atcccgggcctgtttgccgtgggcgaaatcgcttgcgtatcggtacacggcgccaaccgt
ctgggcggcaactcgctgctggatctggtggtattcggtcgtgcagccggtatgcattta
caggaatctctggcggagcagggcgagagccgtgatgccagcgaatcggatgtggatgcg
tcgctggagcgactgaaccgctggaacaacacccgttcgggtgaggatccggtcgaaatt
cgcaaggcgctgcaagcctgtatgcagcacaacttctcggtattccgtgaaggtgatgcc
atggcgaaagggctggaagagttgaaagagatccgtgaacgtctgaagaacgcgcgcctg
gacgatacctccagcgaattcaacacccagcgcatcgaatgcctggagttggataacctg
atggagactgcgttttccaccgccgtgtcggccaacttccgtaccgagagccgtggagcg
cacagccgcttcgatttcccggaacgcgatgacgccaactggctgtgccattcgctgtat
cagccgcaatcggaaagcatgacgcgtcgtgaagtgaacatgcaaccgaagctgcgcccg
gcattcccaccgaaagtgcgttcctactga

DBGET integrated database retrieval system