KEGG   Serratia sp. AS13: SerAS13_1977Help
Entry
SerAS13_1977      CDS       T02012                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sra  Serratia sp. AS13
Pathway
sra00020  Citrate cycle (TCA cycle)
sra00480  Glutathione metabolism
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
sra01120  Microbial metabolism in diverse environments
sra01130  Biosynthesis of antibiotics
sra01200  Carbon metabolism
sra01210  2-Oxocarboxylic acid metabolism
sra01230  Biosynthesis of amino acids
Module
sra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sra_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SerAS13_1977
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SerAS13_1977
Enzymes [BR:sra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SerAS13_1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AEG27761
LinkDB All DBs
Position
2130648..2131901
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKQITVDAQGKLVVPNNPIIPFIEGDGIGVDVTPAMIHVVDAAVKKAYHG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYQGTPSPVKQPELTDMVIFRENAEDIYAGIEWKAGSAEADKVIKFL
RDEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEG
AFKDWGYELAREEFGGELIDGGPWLKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGSDCALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIVKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaaacagattacggtcgatgcccagggt
aaactggttgttccgaataacccgatcatcccgttcatcgaaggcgacggcattggcgtt
gacgttacccctgctatgattcacgtggttgatgcggctgtgaaaaaggcctaccacggc
gaacgtaaaatctcctggatggaaatctacaccggtgaaaaatccactcacgtttacggg
aaagacgtgtggctgccggaagaaaccctggatctgatccgtgactaccgcgttgccatc
aaaggcccgctgactaccccggtcggtggcggtattcgctccctgaacgtggctctgcgc
cagcaactggatctgtatgtgtgtctgcgtccggtgcgttactaccagggcacccctagc
ccggttaaacagccagagctgaccgacatggtgatcttccgcgaaaacgccgaagacatc
tatgcgggtatcgaatggaaagccggttctgccgaagcagacaaagtgatcaagttcctg
cgcgacgaaatgggcgtgaagaaaatccgcttcccggaacaatgcggtatcggcgtcaag
ccatgttccgaagaagggaccaaacgtctggtgcgtgcggcgatcgaatatgccatcacc
aacgaccgtgactctgtgaccctggttcacaaaggcaacatcatgaagttcaccgaaggt
gccttcaaggattggggctacgaactggcgcgcgaagagtttggcggcgaactgatcgac
ggcggcccgtggctgaaaatcaagaacccgaacaccggtaaagagatcgtggttaaagac
gtgatcgccgacgccttcctgcagcaaatcctgctgcgcccggcggaatacgacgtgatc
gcctgtatgaacctgaacggtgactacatctccgacgccctggccgcacaggttggcggt
atcggtatcgcaccaggcgccaacatcggttccgattgcgcgctgttcgaagcgacccac
ggcaccgcacctaagtatgccggccaggacaaagtgaacccaggttccatcatcctgtcc
gcagaaatgatgctgcgtcacatgggctggttcgaagcggctgacctgatcgttaaaggc
atggaaggcgccatcgctgccaagaccgtgacctatgacttcgaacgcctgatggaaggc
gctaaactgctgaaatgttcagagtttggcgacgctatcgttaagcacatgtaa

DBGET integrated database retrieval system