KEGG   Serratia sp. AS13: SerAS13_2634Help
Entry
SerAS13_2634      CDS       T02012                                 

Definition
(GenBank) Beta-lactamase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sra  Serratia sp. AS13
Pathway
sra00550  Peptidoglycan biosynthesis
sra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SerAS13_2634
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sra01002]
    SerAS13_2634
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sra01011]
    SerAS13_2634
Enzymes [BR:sra01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SerAS13_2634
Peptidases and inhibitors [BR:sra01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SerAS13_2634
Peptidoglycan biosynthesis and degradation proteins [BR:sra01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SerAS13_2634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AEG28412
LinkDB All DBs
Position
complement(2831749..2832918)
Genome map
AA seq 389 aa AA seqDB search
MKRSVLSVITGIWLPLAVQAADAPLSFPLNTPPAIDAASYVLMDYTTGQVLAENNADERR
NPASLTKLMTGLVIDHALDQHKIGLDDVVTVGKDAWAQGNPVFKGSSLMFLKPGDRVTVR
DLSRGIIIDSGNDACVAMADYVAGSQAAFVKLMNEKSTQLGLQNTHFETVHGLDAPGQFT
TAGDLAVISRAIIMSEPAEYHMYSEKSLSWNGITQQNRNGLLWDKNLRVDGLKTGHTESA
GFNIIASATEGDRRLIAVVMGGKSAKGREDQARKLLTWGLRDFATVHLFSAGQTLGQEKV
WYGDRHLVPVGSEQDQYLSLPKREADKLKAQYVITPSRLDAPLAQGQPIGEIRISDNGKL
LKTLPLVVLQPVNNGGMFSRLMDYAKLKL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgttcagtattgtctgtgataaccggaatttggctgccgttggcggtacaggcg
gcggatgcgccactcagtttccctctcaatacaccgccggcgatagacgcggcttcttac
gtattgatggattacaccaccggtcaggtactggcggagaacaatgcggacgagcggcgc
aatccggccagcctgaccaaactgatgaccggattggtgattgatcatgcgctcgatcag
cacaaaattggcctggatgacgtggtgaccgtgggcaaagacgcctgggcgcagggcaat
ccggtgttcaagggttcctcgctgatgttcctgaaacccggtgacagggtcacggtgcgc
gatctcagtcgcggcattattattgactccggcaacgatgcctgcgtggcgatggcggac
tacgtggcgggcagccaggccgcgttcgtcaaactgatgaatgaaaaaagcactcagctt
ggcctgcaaaatacccattttgaaaccgtccacgggctggacgcgccaggccagttcact
acggccggcgatctggcggtgatttcgcgtgccatcatcatgagcgaaccggcggaatat
catatgtacagcgagaaatcgctgtcctggaacgggattacccaacagaaccgcaatggg
ctgctgtgggataaaaacctgcgggttgatggcctgaaaacgggccataccgaatcggcc
ggttttaacattattgcctccgcaaccgaaggcgaccggcgtttgattgctgtcgtgatg
ggcggtaaaagcgcaaaagggcgagaagatcaggcccgtaaactgctgacctggggtctg
cgagattttgccaccgtgcatctgtttagtgccgggcaaacgctggggcaggaaaaagtg
tggtatggcgatcgccaccttgtgccggtgggcagtgagcaggatcaatacctcagcctg
ccaaagcgcgaggcggacaagttgaaagctcagtatgtgataaccccgtcgcgccttgac
gccccgttggcacaggggcagccgattggggagatccgcatcagcgataacggcaaactg
ttgaaaaccctgccgctggtggtgctgcagccggtaaacaacggcggtatgttctcgcgc
ctgatggactatgcgaagctgaaactctga

DBGET integrated database retrieval system