KEGG   Serratia sp. AS13: SerAS13_3969Help
Entry
SerAS13_3969      CDS       T02012                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
sra  Serratia sp. AS13
Pathway
sra00061  Fatty acid biosynthesis
sra00780  Biotin metabolism
sra01100  Metabolic pathways
sra01212  Fatty acid metabolism
Module
sra_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SerAS13_3969
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SerAS13_3969
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sra01004]
    SerAS13_3969
Enzymes [BR:sra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SerAS13_3969
Lipid biosynthesis proteins [BR:sra01004]
 Fatty acid synthase
  Component type
   SerAS13_3969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AEG29727
LinkDB All DBs
Position
complement(4238411..4238866)
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLDIAEILELLPHRYPFLLVDRVLEFEEHKFLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVATVDGKIVCEATMMCARSRES
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctggatattgcagaaattttggagttgcttcctcaccgt
tacccgttcttgctggtcgatcgcgtccttgagtttgaggagcacaaattcctgcgtgcg
gtgaagaacgtatctgtaaatgagccgtttttccaggggcacttccctggtaagccgatt
tttccaggcgtattgattctggaagcaatggcgcaggctaccggtattctggcgtttaaa
agcgtcggcaaactggagccgggcgaattgtattactttgccggtatcgacgaagcccgt
ttcaaacgaccggtagtgccaggcgatcagatgatcatggaagtcacctttgagaaaact
cgtcgtggtctgacgcgcttcaaaggcgtagcgaccgttgacggcaaaattgtttgcgaa
gcaaccatgatgtgcgcgcgcagccgggagtcttaa

DBGET integrated database retrieval system