KEGG   Serratia sp. AS13: SerAS13_4415Help
Entry
SerAS13_4415      CDS       T02012                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sra  Serratia sp. AS13
Pathway
sra00650  Butanoate metabolism
sra01100  Metabolic pathways
sra01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SerAS13_4415
   00650 Butanoate metabolism
    SerAS13_4415
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SerAS13_4415
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SerAS13_4415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sra01007]
    SerAS13_4415
Enzymes [BR:sra01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SerAS13_4415
Amino acid related enzymes [BR:sra01007]
 Aminotransferase (transaminase)
  Class III
   SerAS13_4415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEG30167
LinkDB All DBs
Position
complement(4766899..4768164)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQDATPRGIGVMCGFYAERAENATLWDVEGNEVIDFASGIAVLNTGHRHPK
VIAAIEQQLKAFTHTAYQIVPYESYVSLAERINQRAPIEGPCKTALFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVTTE
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNIAPADFMQALRELCDQHGILLIADEV
QTGFARTGKLFAMEHYAVKPDLITMAKSLAGGMPLSAVAGRADVMDAPAPGGLGGTYAGN
PLAVAAALAVLDVIDEEQLCQRSQRLGQHLVEVLQQARKTSPAIADIRAQGSMVAVEFKD
PATGKPSAEITRQVQQKALEEGLLLLSCGVNGNVIRFLYPLTIPEEQFTQALGILSRALA
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaatcaacgtcgtcaggatgccaccccacgggggattggcgtg
atgtgcggtttttacgccgagcgtgcggagaatgccacgctgtgggacgtagaaggcaat
gaggtgatcgatttcgcttccggtattgctgttctgaataccggacaccggcatccgaag
gtgatcgccgccattgaacagcaactgaaggccttcacccacaccgcttaccaaatcgtt
ccttacgaaagctatgtctcgttggcagagcgcatcaaccagcgcgcaccgatcgaaggc
ccctgtaaaaccgcgttgttcaccaccggcgccgaagcggtggaaaacgcggtcaaaatc
gcccgcgcctataccggccgaccgggcctgatcacctttggcggcggtttccatggccgc
acttacatgaccatggcgctgaccggcaaagtggctccgtacaagctgggcttcgggccc
ttccccggttcggtgttccacggccagtatccgaatgcgctgtatggcgtgaccaccgaa
gacgcgatgaacagcctggagcgcatctttaaggcggatatcgatcccaaacaagtggcc
gccattgtgctggaaccggtgcagggcgagggcggtttcaacattgcgccggccgatttt
atgcaggcgctgcgcgaactgtgcgaccagcacggcattttgctgattgccgacgaagtg
cagaccggttttgcccgtaccggcaagctgtttgccatggaacattacgcggtgaaaccg
gatctgatcactatggcgaaaagcctggcgggcggtatgccgctgtcggcggtggccggc
cgtgccgacgtgatggacgccccggcgccgggcgggctgggcggcacttatgccggtaac
ccgctggcggtggctgcggcacttgcggtgctggacgtgattgacgaagaacagctgtgc
cagcgttcccaacgtttgggccagcatttggtggaggtgctgcaacaggcgcgcaaaacc
agcccggcgatcgcggatattcgcgcgcagggatcgatggtggcggtggagttcaaggat
ccggcgaccggcaagccttcggcggagatcacccgtcaggtacagcagaaggcgctggag
gaggggctgttgctgttgagctgcggtgtgaacggtaacgtgatccgcttcctgtatccg
ctgaccatccctgaggagcagttcacccaggcgctgggcattctttcccgcgcgttggcc
caataa

DBGET integrated database retrieval system