KEGG   Serratia sp. AS13: SerAS13_4539Help
Entry
SerAS13_4539      CDS       T02012                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sra  Serratia sp. AS13
Pathway
sra00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SerAS13_4539
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sra02000]
    SerAS13_4539
Enzymes [BR:sra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SerAS13_4539
Transporters [BR:sra02000]
 Other Transporters
  Pores ion channels [TC:1]
   SerAS13_4539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AEG30291
LinkDB All DBs
Position
complement(4904383..4905051)
Genome map
AA seq 222 aa AA seqDB search
MIIVHHLNNSRSQRILWFLEELGVPYQVQRYQRDPQTLLAPPELKKIHPLGKSPVIVDGD
LTLAESGAIIEYLQEAYDAQGLFIPTDHHARQQYRYWLHYAEGSLMPLQVMKLVFSRLGQ
SPVPWLLRPVAGAIGKGVQREYLDKQIATHRDYLEQHLSKSTWFVGNEFSAADIQMSFPL
EAMAARGSLDNCPKLRGYLQRIHSRPAYQRALEQGGPYELLS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgtgcaccatctgaataattcacgctcgcagcgcatcctgtggtttctggag
gagctgggtgtgccgtaccaggtgcagcgttaccagcgcgacccgcaaaccctgctggcg
ccgccggagttgaaaaagatccacccgttgggcaaatccccggtgattgtcgatggcgat
ctgaccctggcggaatccggcgccattatcgaatatttgcaagaagcctacgatgcccag
ggattgtttatcccgactgaccatcatgctcgccaacaataccgttactggctgcattat
gcggaaggatcgctgatgccgctgcaggtcatgaagctggtgttcagccgcctgggtcaa
tcgccggtcccctggctgttgcggccggtagcaggggcgattggcaaaggggttcagcgg
gagtatctggacaaacagatcgctacgcatcgcgattatcttgagcagcacctgagcaaa
agcacctggtttgtcggcaatgaattcagcgcggcggatatccagatgagctttccgctg
gaagcgatggcggcgcgcggttcgctggacaattgcccgaagctgcgcggttatctgcag
cgtattcattcccggccagcctaccagcgggcgctggagcagggcggcccttatgaattg
ctgagctga

DBGET integrated database retrieval system