KEGG   Serratia sp. AS13: SerAS13_4735Help
Entry
SerAS13_4735      CDS       T02012                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sra  Serratia sp. AS13
Pathway
sra00564  Glycerophospholipid metabolism
sra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SerAS13_4735
Enzymes [BR:sra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SerAS13_4735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_oxidored 3HCDH_N Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AEG30487
LinkDB All DBs
Position
5105888..5107396
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRTSLPGS
KSLRFGPESVLKPDLKRGFEYSDCWVDDARLVVLNAQEVEKRGGEVRTRTKVTRAWRENG
LWMVEAVDVDSGKTFTWRAKGLVNATGPWVKHFFDDGLKLKSPYGIRLIKGSHIVVPRAH
NQPQSYILQNEDHRIVFVIPWNDEFSIIGTTDVEYHGDPKDVKIDDNEIDYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVHDEQGKAPLLSVFGGKLTTYRK
LAEHAMEKLAHYYPGCGPAWTKNGSLPGGDIGGDRDSYAAKLRREHGWLPESLARRYART
YGSHSELILANANGLSSLGEEFGHGLYEAELRYLVEKEWVVELEDAIWRRTKLGMWLDDA
QQARVKAWLAQHTKTKTLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggcggcatcaacggtgccggcatcgcggcg
gatgctgccgggcgcgggctgtccgtactgctactggaagcgcaagacttggcctgcgct
acgtcttccgccagttccaaactgatccacggcggcctgcgctacctggaacactacgaa
ttccgcctggtgagcgaagcgctggccgagcgtgaagtgttgctgaagctggcgccgcac
atcgcgttccccatgcgtttccgcctgccgcaccagccgcatctgcgcccggcctggatg
atccgcatcggcctgttcctgtacgatcacctgggcaaacgcaccagcctgccgggcagc
aagagtttgcgatttggaccagaatcggtacttaagcctgatctgaagcgcggtttcgaa
tattccgactgctgggtggatgatgcccgcctggtggtgctgaacgcacaggaagtggaa
aaacgcggcggtgaagtacgcacccgcaccaaagtgacccgtgcatggcgtgaaaacggc
ctgtggatggtggaagcggttgacgtcgacagcggtaaaacctttacctggcgcgccaag
ggcctggtcaacgccaccggcccttgggtgaaacacttcttcgacgacggcctgaagctg
aaatccccgtacggcatccgcctgatcaaaggcagccatatcgtggtgccacgtgctcac
aaccagccgcagtcctatattctgcaaaacgaagaccaccgcatcgtattcgtgatcccg
tggaatgacgaattctcgatcatcggcaccaccgacgtggaataccacggcgatccgaaa
gacgtgaagatcgacgataacgagatcgactacctgctgaaagtgtacaacgaccacttc
aagaagcagttgggccgtgacgacatcgtctggacctactccggtgtgcgtccgctgtgc
gatgacgaatccgattcgccgcaggcggtgacccgcgactacacgctggacgtgcatgac
gagcagggcaaagcgccgctgctgtcggtgttcggcggtaaactgaccacctatcgcaag
ctggctgaacatgcgatggaaaaactggcgcattactaccctggctgcggcccggcgtgg
accaaaaacggttcgctgcccggcggcgacatcggtggcgatcgcgacagctatgccgcc
aaactgcgccgcgaacacggctggttgccggaatccctggcgcgccgctacgcccgcacc
tacggcagccacagcgagctgatcctggcgaatgccaacggcctcagcagcctgggcgaa
gagtttggtcacggcctgtatgaagccgaactgcgctatctggtagagaaagagtgggtg
gtcgagctggaagacgccatctggcgccgcaccaagctgggtatgtggctggatgatgcg
cagcaggcgcgggtgaaagcctggctggcgcaacacacgaaaacgaaaacgctctctctg
gcttcctga

DBGET integrated database retrieval system