KEGG   Serratia sp. AS13: SerAS13_4878Help
Entry
SerAS13_4878      CDS       T02012                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sra  Serratia sp. AS13
Pathway
sra00620  Pyruvate metabolism
sra00680  Methane metabolism
sra01100  Metabolic pathways
sra01120  Microbial metabolism in diverse environments
sra01200  Carbon metabolism
Module
sra_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SerAS13_4878
  09102 Energy metabolism
   00680 Methane metabolism
    SerAS13_4878
Enzymes [BR:sra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SerAS13_4878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEG30629
LinkDB All DBs
Position
5279880..5282516
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKDALGEHILDRVETIRKLSKSSRAGNEAHRQELLSTL
QNLSNDELLPVARAFSQFLNLTNVAEQYHSISPNGEAASNPEALAQLFTRLKDKKLSTKE
LQNAVSQLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKNRPSPIDEAKWGFAVVENSLWEGVPAFLREFNEQLENSIDYSLPAEAV
PVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKACDLFTRDIQVLVSELSMTECTPELRA
LAGGDEVQEPYREIMKQLRGQLMRSQAYLEGRLKGERVLKPNDLLVSNDQLWEPLFACYQ
SLQACGMGIIANGQLLDTLRRVRCFGVPLVRIDVRQESNRHTEAIAELTRYLGLGDYESW
SEADKQAFLIRELNSKRPLVPLKWEPSADTQEVLETCRVIAEAPQGSIAAYVISMARTPS
DVLAVHLLLKEAGCPFALPVAPLFETLDDLNNADDVMTQLLNIDWYRGFIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGVALTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVAISSLALYAGAVLEANLLPPPEPKKEWRSLMDDLS
ETSCKMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRKPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQEAVKAGKQNQLEAMCRDWPFFSTRIAMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLESDIKVVLTIANDAHLMEDLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEHPDTRVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattcggcaatgcgaagtaatgtcagtatgctcggcaaattgctcggc
gataccatcaaagatgcgctgggcgagcatattctcgatcgcgttgaaactatccgtaag
ctttccaaatcttcacgtgccggtaacgaggcgcaccgtcaggagctgctttccaccttg
cagaacctgtccaacgacgagttgctgccggtcgcgcgcgccttcagccagttccttaat
ctgaccaacgtcgccgagcagtaccacagcatttcgcccaatggcgaagccgccagcaat
cccgaagcgctggcccaactgttcacccggctgaaagacaaaaagctcagcaccaaagag
ctgcaaaatgcggtctctcagctctccatcgagctggtgctgactgcgcacccgacggaa
atcacccgccgcaccctgatccacaagctggttgaggtcaacacctgtctgagccaactc
gatcataacgatctggccgattacgagcgcaacaagatcatgcgccgcctgcgccagttg
gttgcccagtcatggcacaccgacgagatccgtaaaaaccgcccttcacctatcgacgaa
gccaagtggggctttgcggtggtggaaaacagcctgtgggaaggggtgcctgccttcctg
cgcgaattcaacgagcagttggaaaactccatcgattacagcctgccggcggaagccgtg
ccggttcgcttcacctcctggatgggcggtgaccgcgacggtaacccgaacgtgaccgcc
gaaattacccgtcatgtgctgctgctcagccgctggaaagcctgcgacctgttcacccgc
gatatccaggtgttggtgtccgagctgtcgatgaccgaatgtaccccggaattgcgtgcc
ctcgccggtggcgacgaagtgcaggaaccgtaccgcgaaatcatgaaacagctgcgcggc
cagttgatgcgttctcaggcctatctggaaggccgcctgaagggcgaacgcgtgctgaag
ccgaacgacctgctggtaagcaacgatcagctgtgggaacctttgttcgcctgttatcag
tcgctgcaggcctgcggcatgggcatcattgccaacggtcagttgctggataccctgcgc
cgtgtccgttgctttggcgtgccgctggtgcgtatcgacgtccgtcaggaaagcaaccgc
cataccgaagccatcgccgaactgacccgttatctgggcctcggcgactacgaaagctgg
tcagaagccgacaaacaggcattcctgatccgcgaactgaactccaaacgcccgctggtg
ccgctgaagtgggaaccgagcgccgacacccaggaagtgctggaaacctgccgcgtgatc
gccgaagcgccgcaaggctccatcgccgcctacgtcatctccatggcacgcaccccttct
gacgtgctggcggtccatctgctgctgaaagaagccggttgcccgtttgcgctgccggta
gcgccgctgttcgaaaccctcgacgacctgaacaacgccgacgacgttatgacccagttg
ctgaatatcgactggtatcgcggctttatccagggcaagcagatggtgatgatcggctat
tccgactcggcgaaagacgccggggtgatggccgcttcctgggcgcagtaccgcgcgcaa
gatgccttgatcaaaacttgtgaaaaggccggagtggcgttaacgctgttccacggccgt
ggcggttcgattggccgcggcggtgcgcctgcacatgcggcgctgctgtcgcagccgccg
ggcagcctgaaaggtggcctgcgcgtgaccgaacagggtgagatgattcgcttcaaattt
ggcctgccggaagtggccatcagcagcctggcgctgtatgccggcgcggttctcgaagcc
aacctgctgccgccgccggagccgaagaaagagtggcgttcgctgatggacgacctgtca
gagacatcatgcaaaatgtaccgcggctacgtgcgcgagaatccggacttcgtgccttac
ttccgcgccgcaacaccggagctggaactgggtaaactgccgctgggttcacgcccggcc
aagcgcaagccaaacggcggcgtagaaagcctgcgcgccattccgtggatcttcgcctgg
acgcagaaccgcctgatgctgccggcctggctcggcgccggcgcaggtttgcaggaagcg
gtgaaagctggcaaacagaatcagttggaagccatgtgccgcgactggccgttcttctcc
acccgcatcgccatgctggaaatggtcttcgccaaggccgacctgtggcttgcggaatac
tacgatcagcgcctggtcgacaaatcgctgtggccactgggtcagcagttgcgcgatcag
ctcgaaagcgacatcaaggttgtgttgaccattgccaatgacgctcacctgatggaagac
ctgccgtggatcgccgaatccatcgcgctgcgcaacgtgtataccgatccgctgaacgtg
ctgcaggcagagctgctgcaccgctcccgccagcaggaacatcctgatacccgcgttgaa
caggcattgatggtcaccattgccggcgtcgccgccggcatgcgcaacaccggctag

DBGET integrated database retrieval system