KEGG   Streptomyces rapamycinicus: M271_02970
Entry
M271_02970        CDS       T02907                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
src  Streptomyces rapamycinicus
Pathway
src00997  Biosynthesis of various secondary metabolites - part 3
src01100  Metabolic pathways
src01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    M271_02970
Enzymes [BR:src01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     M271_02970
SSDB
Motif
Pfam: DeoC THF_DHG_CYH_C
Other DBs
NCBI-ProteinID: AGP52225
LinkDB
Position
complement(724863..725582)
AA seq 239 aa
MSDGPVVSQARWNGLLRALVDGGADAVVVHKGRARAIAPDILRHCALVVHLSAGTVHAAD
TDAKVLVGDVEEAVRLGADAVSVHVNLGSDTEHRQLKDLGTVAASCDLWNMPLLAMIYPR
GPRIADPHDPALLAHAVNIAADLGADLVKTSVALPMERMAEVVNSCPLPILAAGGPPDGS
DLVSHGTSLMLAGCRGLAVGRRIFSSPSPSSLVARLAAVVHAAEAGTTPHPSTIATGAA
NT seq 720 nt   +upstreamnt  +downstreamnt
gtgtccgatgggccggtggtgtcccaggcccgctggaacgggctgctccgggcactggtg
gacggcggcgcggacgcggtcgtcgtccacaagggccgggcgcgggcgatcgcgccggac
atcctgcgccactgcgccctggtggttcacttgagcgcgggcaccgtgcacgcggccgac
accgacgccaaggtgctcgtcggcgacgtggaagaggccgtacggctgggcgcggacgcg
gtgagcgtgcatgtgaacctcggctcggacaccgagcaccggcaactgaaggacctcggg
accgtcgcggcctcgtgcgacctctggaacatgccgctgctcgcgatgatctacccgagg
gggccgcggatcgccgatccgcacgacccggcgctgctcgcccatgccgtcaacatcgcc
gcggatctcggcgccgacctcgtgaagacctcggtcgccctgccgatggagcggatggcc
gaggtggtgaacagctgtccgctgccgatcctcgccgccggtggcccgcccgacggctcg
gacctggtcagccatgggacgtcattgatgctcgcgggctgccggggcctcgcggtgggc
cgccggatcttctcctcgccctcaccctcctcgctggtggcacggctcgccgccgtggtg
cacgccgccgaagccggaacgaccccccacccctcgacgatcgcgacaggagccgcatga

DBGET integrated database retrieval system