KEGG   Streptomyces rapamycinicus: M271_10810Help
Entry
M271_10810        CDS       T02907                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
src  Streptomyces rapamycinicus
Pathway
src00020  Citrate cycle (TCA cycle)
src00480  Glutathione metabolism
src01100  Metabolic pathways
src01110  Biosynthesis of secondary metabolites
src01120  Microbial metabolism in diverse environments
src01130  Biosynthesis of antibiotics
src01200  Carbon metabolism
src01210  2-Oxocarboxylic acid metabolism
src01230  Biosynthesis of amino acids
Module
src_M00009  Citrate cycle (TCA cycle, Krebs cycle)
src_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M271_10810
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    M271_10810
Enzymes [BR:src01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     M271_10810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AGP53763
UniProt: A0A0A0NCD9
LinkDB All DBs
Position
complement(2866337..2868556)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVIEAYASTAGVGVESRDISLAGRIIAQFPEHLEEGQ
RIPDALAELGDLAKTPEANIIKLPNISASIPQLKAAVAELQQQGYALPDYPDDPKTDEER
KIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYARANPHRMGAWTADSKTNVSHMDTDD
FRSTEKSVVIPEDGSLRIELAGDDGSTTVLRESVPVLAGEVVDASVMRVAALREFLSAQV
ARAKAEGVLFSLHLKATMMKVSDPIVFGHGVRAFFPKTFAEHGETLAAAGLTPNDGLGGI
LKGLEALPEGAAIKASFDAELAEGPELAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGEEHDTLAVIPDSSYAGIYQAVIDDCRAHGAFDPATMGSVPNVGLMAQKAEEYGS
HDKTFEIPTTGTVRVLDGAGNAVIEQVVGAGDIFRMCQTKDVPIQDWVKLAVTRARATGD
PAVFWLDEGRAHDANLIEKVKAYLPEHDTEGLDIRILAPVEAIKLSLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLINGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEHLAQKTGNARAQVLADTLDRATGTFLAENKSPSRRVGGIDNRGSHFY
LALYWAQELAKQTDDADLAKAFAQLADTLSTQEQTIVDELLAVQGSPADIGGYYRPDTAK
AAAVMRPSATLNQALATLG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacacggacgaggcccctgccctcgcgacgtac
tcgttcctgccggtgatcgaggcgtatgcctccaccgccggggtcggcgtggagagccgg
gacatctccctggcgggccggatcatcgcccagttccccgagcacctggaagagggccag
cgcatccccgacgccctcgccgagctgggtgacctcgccaagacccccgaggccaacatc
atcaagttgccgaacatctcggcctcgatcccgcagctgaaggccgcggtcgccgagctg
cagcagcagggctacgcgctgccggactacccggacgacccgaagaccgacgaggagcgg
aagatccgcgcccgttacgacaaggtcaagggctccgcggtgaacccggtgctgcgcgag
ggcaactccgaccgccgcgcccccgcctcggtgaagaactacgccagggccaatccgcac
cgcatgggcgcctggacggccgattccaagaccaatgtgtcccatatggacaccgacgac
ttccgctccaccgagaagtccgtggtgatcccggaggacggctcgctgcgcatcgagctg
gcgggcgacgacggctccaccaccgtgctgcgcgagtccgtaccggtgctggcgggcgag
gtcgtggacgcctccgtgatgcgcgtcgcggcgctgcgcgagttcctctcggcgcaggtg
gcccgcgccaaggcggagggcgtgctgttctccctgcacctgaaggccacgatgatgaag
gtctccgacccgatcgtcttcggccacggcgtacgtgccttcttccccaagaccttcgcc
gagcacggtgagaccctcgccgccgccggtctgaccccgaacgacggtctgggcggcatc
ctcaagggcctggaggccctgcccgagggcgcggcgatcaaggcgtccttcgacgccgag
ctggccgagggcccggagctggccatggtcgactccgaccgcggcatcaccaacctgcat
gtgccgtccgacgtcatcgtcgacgcctccatgccagccatgatccgtacctccggccac
atgtggggcccggacggcgaggagcacgacaccctcgcggtgatcccggacagcagctac
gccgggatctaccaggccgtcatcgacgactgccgcgcccacggcgccttcgacccggcc
acgatgggctcggtgcccaacgtcggcctgatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatccccaccacgggcaccgtccgcgtcctggacggggcgggc
aacgcggtcatcgagcaggtcgtcggcgccggtgacatcttccggatgtgccagaccaag
gacgtgccgatccaggactgggtcaagctggccgtcacccgcgcccgcgccaccggcgac
ccggccgtcttctggctggacgagggccgcgcccacgacgccaacctcatcgagaaggtc
aaggcgtacctgccggagcacgacaccgagggcctggacatcaggatcctggccccggtc
gaggcgatcaagctctccctcgagcggatccgccgcggcgaggacacgatctcggtcacc
ggcaacgtcctgcgtgactacctgaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctctcggtcgtcccgctgatcaacggcggcggtctgttcgagaccggcgcg
ggcggctcggcgcccaagcacgtccagcagctggtcaaggagaactacctgcgctgggac
agcctgggcgagttcctggccctcgcggtcagcttcgagcacctcgcgcagaagacgggc
aacgcgcgggcccaggtcctcgccgacaccctcgaccgggcgaccggcaccttcctggcc
gagaacaagtcgcccagccgtcgcgtaggcggtatcgacaaccgcggcagccacttctac
ctggccctgtactgggcccaggagctggccaagcagaccgacgacgccgacctggccaag
gcgttcgcccagctcgccgacacgctctccactcaggagcagacgatcgtcgacgagctg
ctcgcggtccagggctccccggccgacatcggcggctactaccggcccgacaccgccaag
gccgcggccgtcatgcgcccgtccgcgaccctcaaccaggccctcgccaccctcggctga

DBGET integrated database retrieval system