KEGG   Streptomyces rapamycinicus: M271_11895
Entry
M271_11895        CDS       T02907                                 

Definition
(GenBank) alkaline phosphatase
  KO
K04342  streptomycin-6-phosphatase [EC:3.1.3.39]
Organism
src  Streptomyces rapamycinicus
Pathway
src00521  Streptomycin biosynthesis
src01100  Metabolic pathways
src01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M271_11895
Enzymes [BR:src01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.39  streptomycin-6-phosphatase
     M271_11895
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Other DBs
NCBI-ProteinID: AGP53976
LinkDB
Position
3116511..3117866
AA seq 451 aa
MHRPSRRHLTLATATVVAAAAVAATTSAGAFDSTEQARSAIKGGKARNVILLIGDGMGDS
EMTLARDYTVGADGRLNLDKFPLTGAYTTYAVHADGTPDYVTDSAASGTGWATGHKTVNG
RISKTPGTDKAVPTILELAQKNGYATGSVTTSELTDATPAVLASHATDRSCQGPADMAKC
PADTIAAGGPGSIAEQSVNHKVDVLLGGGKARFDQKVTDGTFKGMTVTEQARKLGYQVVT
DDAGMKNAKPGKPVLGLFASGNVPVEWTGKAAAAGGTAPQRCVTSNSGRPAATPSLADSA
TKAIQLLEAKRKHSENGFFLQVEGASIDKQDHAADPCGQIGETAAFDRAVKVARDYAAKH
PDTLVVTTADHGHTSQIVPLEATPPGLSSTLVTDEGRQLKVNYSTNTPGQSQEHTGTQVR
IAAQGPEAYRVLGVTNQTDLFTTVREALRLR
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgcacagaccctcccgtcgtcacctcaccctcgccacggccacggttgtcgcggctgcc
gccgtggccgccaccacctccgccggcgccttcgacagcacggagcaggcccggagcgcc
atcaagggcgggaaggcgaggaacgtcatcctgctgatcggcgacggcatgggtgactcg
gagatgacgctggcccgtgactacacggtcggggccgacggccggctgaacctggacaag
ttcccgctcaccggcgcctacaccacctacgcggtccacgccgacggcaccccggactac
gtcaccgactccgccgccagcggcaccggctgggcgaccggccacaagaccgtcaacgga
cgcatctccaagacgccgggcaccgacaaggccgtgccgacgatcctggagctcgcgcag
aagaacggatacgccaccggcagcgtcaccacctccgagctcaccgacgccacccccgcg
gtgctcgcctcccacgccaccgaccgctcctgccagggcccggccgacatggccaagtgc
cccgccgacacgatcgccgcgggcggccccggctcgatcgccgaacagtccgtgaaccac
aaggtcgacgtcctcctcggcggtggcaaggcacggttcgaccagaaggtcaccgacggc
accttcaagggcatgaccgtcaccgagcaggcacggaagctcggctaccaggtggtcacc
gacgacgcgggcatgaagaacgccaagcccggcaagcccgtactgggcctgttcgcctcc
ggcaacgttccggtggaatggaccggcaaggcggccgcggccggcggaacggcccctcag
cggtgcgtgacctccaactccggccgcccggcggccacgccgagcctggccgactccgcc
accaaggcgatccagctgctggaggccaagcggaagcactccgagaacggcttcttcctc
caggtcgagggcgcctccatcgacaagcaggaccacgcggccgacccgtgcggccagatc
ggcgagaccgccgccttcgaccgcgcggtgaaggtggcccgcgactacgccgccaaacac
ccggacaccctcgtggtcaccaccgccgaccacggccacaccagccagatcgtgccgctg
gaggccaccccgcccggcctgtcctccaccctcgtcaccgatgagggccggcagctcaag
gtcaactactccaccaacaccccggggcagtcccaggagcacaccggcacccaggtacgc
atcgccgcccaggggcccgaggcgtaccgcgtcctcggggtgaccaaccagaccgacctg
ttcaccaccgtccgcgaggccctgcgcctgcgctga

DBGET integrated database retrieval system