KEGG   Streptomyces rapamycinicus: M271_12350Help
Entry
M271_12350        CDS       T02907                                 

Definition
(GenBank) hypothetical protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
src  Streptomyces rapamycinicus
Pathway
src00071  Fatty acid degradation
src00280  Valine, leucine and isoleucine degradation
src00281  Geraniol degradation
src00310  Lysine degradation
src00360  Phenylalanine metabolism
src00362  Benzoate degradation
src00380  Tryptophan metabolism
src00410  beta-Alanine metabolism
src00627  Aminobenzoate degradation
src00640  Propanoate metabolism
src00650  Butanoate metabolism
src00903  Limonene and pinene degradation
src00930  Caprolactam degradation
src01100  Metabolic pathways
src01110  Biosynthesis of secondary metabolites
src01120  Microbial metabolism in diverse environments
src01130  Biosynthesis of antibiotics
src01212  Fatty acid metabolism
Module
src_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    M271_12350
   00650 Butanoate metabolism
    M271_12350
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M271_12350
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M271_12350
   00310 Lysine degradation
    M271_12350
   00360 Phenylalanine metabolism
    M271_12350
   00380 Tryptophan metabolism
    M271_12350
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M271_12350
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    M271_12350
   00281 Geraniol degradation
    M271_12350
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M271_12350
   00627 Aminobenzoate degradation
    M271_12350
   00930 Caprolactam degradation
    M271_12350
Enzymes [BR:src01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     M271_12350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AGP54066
LinkDB All DBs
Position
complement(3229804..3230706)
Genome map
AA seq 300 aa AA seqDB search
MTATWNTPDGATMNDGPVVTYERVGNVAVVRLNRPEYRNAQNSAMTYALDAAYTRAVDDE
RVKVIVLGGNGPHFCAGHDIGTPGRDTDRSFDRKAVLWWDHTDKQGGDQRFARESEVYLG
MCRRWREIPKPMIAMVHGACIAGGLMLAWACDFVIASDDAFFADPVVRMGIPGVEYFAHP
WVMNPRAAKELLFTGDRISAQRCYELGMVNRVVPRERLLEDTLEIAERIGAMPRFGLALA
KKAVNQAEDLQGMRAGMDSVFGLHHFAHAHNAEVAGDTLGGLDARAMGASGARSATGDES
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccacctggaacacgcccgacggagcgacgatgaacgacggcccggtcgtcacc
tacgagcgcgtcggaaacgtggcggtcgtccggctcaaccgtcccgagtaccgcaacgcg
cagaactccgccatgacctacgcgctcgacgccgcgtacacccgcgccgtcgacgacgag
cgggtcaaggtcatcgtgctcgggggaaacgggccgcacttctgcgccgggcacgacatc
ggcacccccggccgggacacggaccggtccttcgaccgcaaggccgtgctctggtgggac
cacacggacaagcagggcggcgaccagcgcttcgcccgcgaatccgaggtgtacctggga
atgtgccgacgttggcgtgagattccgaaaccgatgatcgcgatggtgcacggcgcctgt
atcgccggcgggctgatgctggcatgggcgtgcgacttcgtcatcgcctccgacgacgcc
ttcttcgccgaccccgtggtccggatgggaatccccggggtggagtacttcgcacatccg
tgggtgatgaatcccagggcagccaaggagctgttgttcaccggcgacaggatcagcgct
caacgctgttacgagctgggaatggtgaaccgtgtggtgccgcgtgagcgactgctcgaa
gacacgctggagatcgccgaacgcatcggcgcgatgccccggttcggcctcgcgctggcc
aagaaggcggtcaaccaggcggaggacctgcaaggcatgagggccggcatggattccgtc
ttcggcctgcaccacttcgcacacgcgcacaacgcggaggtggcgggggacaccctgggc
ggcctggacgcccgcgccatgggtgcctccggtgcgcgctccgcgaccggtgacgagagc
tga

DBGET integrated database retrieval system