KEGG   Streptomyces rapamycinicus: M271_12605Help
Entry
M271_12605        CDS       T02907                                 

Definition
(GenBank) xylose isomerase
Organism
src  Streptomyces rapamycinicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AGP54115
LinkDB All DBs
Position
complement(3290858..3291760)
Genome map
AA seq 300 aa AA seqDB search
MSRTGDPGRPTPEPLRFAYGTNGLTDLRLSDALALLADLGYDGVSLTLDHMHLDPLAPDL
AARTRRVARELERLGLGVAIETGARYVLDARRKHHPTLLDPDPEARGARVGLLLRAVRVA
GDLGAPAVHCFSGVLPPGESGETAWRRLADALGPVVVAAGAVGVSLAIEPEPGHLLADLA
GFHRLRTALGDPAALGLTLDIGHCQCLEPDPPAECVRAAAPWVRHVQIEDMRRGVHEHLP
FGEGEIDFPPVLEALRAAGYRGLVGVELPRHSHAGPELARASLRFLKDAERAANEGGVRC
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtaccggcgaccccggccgccccaccccggaacccctccgcttcgcctacggc
accaacggtctgaccgacctgcgcctgagcgacgccctcgccctcctcgccgacctcggc
tacgacggcgtctcgctgaccctcgaccatatgcacctcgacccgctcgccccggacctc
gccgcccgcacccgccgcgtggcccgcgagctcgagcggctcggcctcggtgtcgcgatc
gagaccggcgcccggtatgtgctcgacgcccggcgcaagcaccaccccaccctgctcgac
ccggaccccgaggcccgtggcgcccgggtcggtctgctgctgcgggccgtgcgggtggcg
ggagacctcggggccccggccgtgcactgcttcagcggggtgctgccgcccggtgagtcc
ggggagacggcgtggcggcggctggcggacgccctcgggccggtggtcgtggccgccggg
gcggtgggcgtctccctcgcgatcgagccggagccggggcatctcctcgccgaccttgcc
ggtttccaccggctgcgcacggcgctcggcgatccggccgccctcggcctcaccctcgac
atcggccactgccagtgcctggaacccgacccgcccgccgagtgcgtccgggcggcggcg
ccctgggtgcggcatgtgcagatcgaggacatgcggcgcggggtgcacgaacatctgccg
ttcggcgagggggagatcgacttcccgccggtcctggaggcgctgcgcgcggcggggtac
cggggactcgtcggcgtcgagctgccccgccactcccacgccggtcccgaactggcccgc
gcctccctgcggttcctcaaggacgccgaacgggccgcgaacgagggaggcgtccgatgc
tga

DBGET integrated database retrieval system