KEGG   Streptomyces rapamycinicus: M271_12730Help
Entry
M271_12730        CDS       T02907                                 

Definition
(GenBank) neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
src  Streptomyces rapamycinicus
Pathway
src00511  Other glycan degradation
src00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    M271_12730
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    M271_12730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:src02042]
    M271_12730
Enzymes [BR:src01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     M271_12730
Bacterial toxins [BR:src02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   M271_12730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR_3 BNR Laminin_G_2 Laminin_G_1 DUF4185
Motif
Other DBs
NCBI-ProteinID: AGP54140
UniProt: A0A0A0NIA4
LinkDB All DBs
Position
3321081..3322976
Genome map
AA seq 631 aa AA seqDB search
MLLTAAALALIPLPVRAADTDSSASAARADSGFEQQVLFKSAQEQGYSCFRIPAVVKAKD
GTLLAFAEGRIDNCGDAGDIDLVLKRSTDGGRTWGPLQVVNDGAGDTHGNPAPIVDQRTG
RIVLASTYNTGRDDAQSCDIPCDRSPHLQYSDDNGATWSAPRDLSSSLMPAQWNSWYATG
PVHGIQLQRGHHKGRLVFTLNTETFSGGRITDNHAALAYSDDGGDRWRIGAVDSYPLAED
GTFRQKPSEMTLVERADGSIYVNGREQDGTDLGHRDYAISRDGGQSFTAPFRTIPDLPTP
QVQGSVLRLRDPARDGYSRLLFAAPADPDRRRTMMVRSSWDEARTWDGVDRGKVVTTDWS
GYSDMVAISRDTVGLLYEGGAVDARDEIRFARFTEDWLGSRRPPSPTTDDRAPGARSATV
LGGAAGRDDGRFGDALSFDGTDDAVRVPYRNALPLGTRDFTVSLWFRYSAASGQHPFLWM
GGIGNKQPQVWLRGEPGSNRIRALMTTVNGFATFTSASVSTDAAYNDGQWHHLALVRGGG
RLSLTVDGGTAVTAPDAPGTVSRTAPFGLHLGQAVDSRSYMTGDLDEFRLYARALSDTEL
RRVREFNAPLDGPHSGALVRLPLDRVRSSDN
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
gtgctcctcaccgccgcggcgctggccctgatcccgcttccggtacgggccgcggacacg
gattcctccgcgtccgcggcccgcgccgactccggcttcgaacaacaggtcctcttcaaa
tccgcccaggaacagggctactcctgcttccggatcccggcggtcgtcaaggccaaggac
ggcaccctgctcgccttcgccgagggccggatcgacaactgcggcgacgccggggacatc
gatctggtcctcaagcgctccaccgacggcggccgcacctggggcccgctccaggtggtc
aatgacggcgccggtgacacccacggcaaccccgcgcccatcgtggaccagcgcaccggc
cgcatcgtcctcgccagcacctacaacaccggccgcgacgacgcacagagctgcgacatc
ccctgtgaccgctccccgcacctccagtacagcgacgacaacggcgccacctggtcggcc
ccgcgcgatctgagctcctcgctgatgccggcccagtggaactcctggtacgccaccggc
cccgtccacggcatccagctccagcgcggacaccacaagggccggctggtcttcaccctc
aacaccgagaccttcagcggcggccgcatcaccgacaaccacgccgcgctcgcctacagc
gacgacggcggcgaccgctggcgcatcggcgcggtggacagctacccgctcgccgaggac
ggcaccttccgccagaaaccgtccgagatgactctggtggagcgagccgacggctcgatc
tacgtcaacggccgggagcaggacggcaccgatctcggccaccgcgactacgccatcagc
cgggacggcggccagagcttcaccgcgcccttccgcaccatccccgatctgcccaccccc
caggtgcagggctcggtcctgcggctgcgcgacccggcccgcgacggctacagccgactg
ctcttcgccgcccccgccgaccccgaccgccgccgcaccatgatggtccgctcctcctgg
gacgaggcccgcacctgggacggcgtggaccgcggcaaggtcgtcaccaccgactggtcc
ggctactccgacatggtcgcgatctcccgggacacggtggggctgttgtacgagggcggt
gcggtggacgcccgtgacgagatccgcttcgcccgcttcaccgaggactggctgggttcc
cgccggccgccctcccccaccaccgacgaccgtgcgcccggcgcccggtccgcgaccgtg
ctcggcggcgcggcggggcgcgacgacggccgcttcggcgacgcgctgtccttcgacggc
acggacgacgccgtacgggtcccgtaccggaacgctctgccgctgggcactcgcgacttc
accgtgagcctgtggttccgctactcggccgcctccgggcagcatccgttcctgtggatg
ggcggcatcggcaacaaacagccgcaggtctggctgcggggtgaacccgggagcaaccgg
atccgggcgctgatgaccacggtcaacggcttcgccaccttcaccagcgcctcggtgtcc
accgacgccgcgtacaacgacgggcagtggcaccacctcgccctggtccgcggcggcgga
cggctctccctcaccgtggacggcggcaccgcggtcaccgctcccgacgccccgggcacg
gtgagccgcaccgcgcccttcggcctccatctcggccaggccgtggacagccgctcctat
atgacgggcgatctcgatgagttccggctgtacgcccgtgcgctgtccgacaccgaactg
cgccgtgtccgcgagttcaacgcgccgctcgacggcccccactccggcgccctggtccgc
ctccccctcgaccgcgtgcggtcatccgacaactag

DBGET integrated database retrieval system