KEGG   Streptomyces rapamycinicus: M271_15505Help
Entry
M271_15505        CDS       T02907                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
src  Streptomyces rapamycinicus
Pathway
src00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    M271_15505
Enzymes [BR:src01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     M271_15505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Glyco_hydro_35 Glyco_hydro_14 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: AGP54677
UniProt: A0A0A0N641
LinkDB All DBs
Position
complement(4007849..4009861)
Genome map
AA seq 670 aa AA seqDB search
MPDLNDATRGRVLYGGDYNPEQWPESVWHDDIRLMRRAGVTTVTVGVFSWARLEPRPGAR
DFDWLDRVLGLLHEGGIEVCLATPTASPPPWMGSRHPETLPRDENGTVVWYGSRNQFCAS
SPVYRDHALRITEDLADRYGGHPALRMWHVGNEYGTHCWCDETARHFRRWLRTRYGDLDA
LNEAWGTAFWSQRYDSWEEIIPPRRAQYLINPGQALDFRRFTSDALLECFTAERDALAAR
TPHIPVTTNFHPLFIGQDGWAWAAEEDVVSVDLYPDPKDPHAVAYGALVQDLTRSQAGGP
WVLMEQAAGPVNWRGVNHPKPHGLMRLWSLQAVARGADAVCFFQWRQSRQGSEKFHSGMV
PHAGEHSRTFARVRELGAELRELAPVAGTDVPARAAILHDWHSWWATVQDGRPSSLVSCE
RLLRAWHQALWERNLTTDFAHPHADLTDYALVAVPQLYLLTDEALDNLAAYVRGGGTLVC
GFFTGVVDEDDRVRPGGLDRRLRGLLGIRTVHEWWPLDEGETLTAEGAWLGAFHGTLWSE
DLEPSTAEPVARIKGGELDGRPAVTRNAYGTGTAWYVSTLPEPAALRVLLGRAAEEAGLA
PALPGLPEGVEAVRRGPYLFLLNHGRTPAVVPLPSAPAARTDLLTGRAHHTSVRLDRFAV
MVLAPSEPLA
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacctgaacgacgccacccgcggccgcgtcctctacggcggcgactacaacccc
gagcagtggcccgagagcgtctggcacgacgacatccggctgatgcgccgggcgggcgtc
accaccgtcaccgtcggcgtcttctcctgggcccggctcgaaccccgccccggcgcacgg
gacttcgactggctggaccgggtcctgggcctgctccacgagggcgggatcgaggtgtgc
ctggccaccccgaccgcctccccgccgccctggatgggctcccgccaccccgagaccctg
ccgcgcgacgagaacggcacggtcgtctggtacggctcacggaaccagttctgcgcctcg
tcgcccgtctaccgcgaccacgccctgcgcatcaccgaggacctggcggaccgctacggc
ggccatccggcgctgcggatgtggcacgtcggcaacgagtacggcacccactgctggtgc
gacgagaccgcccggcacttccgccgctggctgcgcacgcggtacggcgacctggacgcc
ctcaacgaggcgtgggggacggccttctggagccagcgctacgactcctgggaggagatc
atcccgccgcgccgcgcccagtacctgatcaaccccgggcaggcgctggacttccgccgc
ttcaccagcgacgccctgctggagtgcttcaccgccgaacgcgacgcgctggccgcccgc
accccgcacatccccgtgaccaccaacttccatccgctgttcatcggccaggacggctgg
gcctgggcggcggaggaggacgtggtctccgtcgacctctaccccgaccccaaggacccg
cacgcggtcgcctacggggcgctggtccaggatctgacccgctcccaggcgggcggcccc
tgggtcctcatggagcaggcggcgggcccggtcaactggcgcggtgtgaaccaccccaag
ccgcacgggctgatgcggctgtggtccctccaggccgtcgcgcgcggcgccgacgcggtc
tgcttcttccagtggcggcagtcccggcagggcagcgagaagttccactccgggatggtc
ccgcacgccggtgagcacagccgcaccttcgcccgggtgcgcgaactcggcgccgagctg
cgcgaactggccccggtcgcgggcacggacgtccccgcgcgggccgcgatcctgcacgac
tggcactcctggtgggccaccgtccaggacggccgcccctcctccctggtctcctgcgaa
cggctgctgcgcgcctggcaccaggccctgtgggagcggaacctcaccaccgacttcgcc
catccgcacgccgacctcaccgactacgccctcgtcgccgtcccccagctgtatctgctg
accgacgaggcgctggacaacctcgcggcgtatgtacgcggcggcgggaccctcgtctgc
ggcttcttcaccggcgtcgtcgacgaggacgaccgggtgcgccccggcgggttggaccgc
cgcctccgcggcctcctcggcatccgtacggtccacgagtggtggccgctggacgagggc
gagacgctcaccgccgagggcgcctggctgggcgcgttccacggcaccctctggtccgag
gacctggagccgtccaccgccgaaccggtagcccggatcaagggcggtgagctcgacggc
cgccccgccgtcacccgcaacgcctacggcaccggcaccgcctggtacgtctccaccctc
cccgaacccgccgccctgcgcgtcctgctcggccgcgccgccgaggaggcggggctggca
cccgcgctgcccggcctccccgagggcgtcgaggcggtgcggcgcggcccgtatctcttc
ctgctcaaccacggccgcaccccggcggtcgtccccctgccgtccgctccggccgcgcgg
acggatctgctcaccgggcgcgcgcaccacaccagcgtccggctggaccgcttcgcggtc
atggtcctggccccatccgaaccccttgcctga

DBGET integrated database retrieval system