KEGG   Streptomyces rapamycinicus: M271_17540Help
Entry
M271_17540        CDS       T02907                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
src  Streptomyces rapamycinicus
Brite
Enzymes [BR:src01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M271_17540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: AGP55069
UniProt: A0A0A0NDK6
LinkDB All DBs
Position
4482534..4482929
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVQVSAHCDLPCGVYDPAQARIEAESVKAVQEKYQANEDPHFRARATTIKEE
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSTDPATGQKALDYIAQ
IDKIFWETKKG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgcctgttcgcccccaaggttcaggtcagtgcccactgcgacctgccctgc
ggtgtgtacgacccggctcaggcccgcatcgaagccgagtccgtcaaggccgtccaggag
aagtaccaggccaacgaggacccgcacttccgtgcccgtgccaccaccatcaaggaggag
cgcgcggagctcgccaagcaccatgtctcggtgctgtggagcgactacttcaagcccccg
cacttcgagaagtaccccgagctgcaccagctggtcaacgacaccctcaaggccctgagc
gcggccaagggctccaccgacccggccacggggcagaaggccctggactacatcgcccag
atcgacaagatcttctgggagaccaagaagggctga

DBGET integrated database retrieval system