KEGG   Streptomyces rapamycinicus: M271_18460Help
Entry
M271_18460        CDS       T02907                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
src  Streptomyces rapamycinicus
Pathway
src00020  Citrate cycle (TCA cycle)
src00190  Oxidative phosphorylation
src00650  Butanoate metabolism
src01100  Metabolic pathways
src01110  Biosynthesis of secondary metabolites
src01120  Microbial metabolism in diverse environments
src01130  Biosynthesis of antibiotics
src01200  Carbon metabolism
Module
src_M00009  Citrate cycle (TCA cycle, Krebs cycle)
src_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
src_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M271_18460
   00650 Butanoate metabolism
    M271_18460
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    M271_18460
Enzymes [BR:src01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     M271_18460
    1.3.5.4  fumarate reductase (quinol)
     M271_18460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like GIDA FAD_oxidored Thi4 FAD_binding_3 Pyr_redox_3 Lycopene_cycl AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AGP55249
LinkDB All DBs
Position
4681101..4683056
Genome map
AA seq 651 aa AA seqDB search
MTQVERQAWDVVVIGAGGAGLRAAIEAREQGMRCAVICKSLFGKAHTVMAEGGIAASMGN
VNERDNWQVHFRDTMRGGKFLNHWRMAELHAQEAPDRVWELETWGALFDRTPEGKISQRN
FGGHEYPRLAHVGDRTGLELIRTLQQKIVSLQQEDKAATGDYESRLKIFQECTVTRIVKD
GDRVAGVFGYERESGRFFTLEAPAVVLATGGIGKSFKVTSNSWEYTGDGHSLALLAGAPL
INMEFVQFHPTGMVWPPSVKGILVTESVRGDGGVLRNSEGKRFMFDYIPDVFKEKYAQSE
DEADRWYEDPDHNHRPPELLPRDEVARAINAEVKAGRGSPHGGVFLDVSTRMSPEVIKRR
LPSMHHQFKELADVDITAEPMEVGPTCHYVMGGVDVDPDTAAATGVPGLFAAGEVAGGMH
GSNRLGGNSLSDLLVFGRRAGLHAARYAQETAASGTRPVPDEAQLDLAAAEALRPFSAEA
GEPDETAGPAGPPENPYTLHQELQQSMNDLVGIIRKAGEMEEALHRLASLRVRARRAGVE
GHRQFNPGWHLAIDLRNMLLVSECVARAALERTESRGGHTRDDCPEMDREWRRLNLVCRL
SDPSGGLATPDAGHGQIRLERRETPPIRPDLLNLFEKDELVKYLTDEELTQ
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagtcgagcggcaggcgtgggacgtggtcgtgatcggcgcgggcggcgccggg
ctgcgtgccgcgatcgaggcccgcgaacagggcatgcgctgcgccgtcatctgcaagtcg
ctgttcggcaaggcccatacggtgatggccgagggcggcatcgccgccagcatgggcaac
gtcaacgagcgcgacaactggcaggtgcacttccgcgacaccatgcgcgggggcaagttc
ctcaaccactggcggatggccgagctgcacgcccaggaggccccggaccgggtctgggag
ctggagacctggggcgcgctcttcgaccgcaccccggagggcaagatctcccagcggaac
ttcggcggccatgagtacccccgcctcgcccatgtcggggaccgcaccggcctggagctg
atccgcaccctccagcagaagatcgtctccctccagcaggaggacaaggccgccaccggc
gactacgagtcccggctgaagatcttccaggagtgcacggtcacccggatcgtcaaggac
ggcgaccgggtcgccggggtcttcggctacgagcgcgaatcgggccgcttcttcaccctg
gaggccccggccgtggtgctggccaccggcggtatcggcaaatccttcaaggtgacctcc
aactcctgggagtacaccggcgacggccattcgctggcgctgctcgcgggcgccccgctg
atcaacatggagttcgtgcagttccatccgaccggtatggtctggccgccctcggtgaag
gggatcctggtcaccgagtcggtgcgcggcgacggcggggtgctgcgcaacagcgagggc
aagcggttcatgttcgactacatcccggacgtcttcaaggagaagtacgcccagtccgag
gacgaggccgaccgctggtacgaggacccggaccacaaccaccgcccgcccgagctgctc
ccccgtgacgaggtggcccgcgccatcaacgccgaggtgaaggcgggccggggctccccg
cacggcggggtcttcctcgacgtctccacccggatgtcccccgaggtcatcaagcggcgg
ctgccctcgatgcaccaccagttcaaggagctagcggacgtcgacatcaccgccgagccc
atggaggtgggccccacctgtcactacgtgatgggcggggtggacgtcgacccggacacc
gcggccgccaccggcgtgcccggcctgttcgccgcgggcgaggtcgcgggcgggatgcac
ggctccaaccggctcggcggcaactccctctccgacctgctggtcttcgggcgccgcgcc
gggctccacgcggcccgctacgcccaggagaccgcggcctccggcacccgcccggtgccg
gacgaggcacagctggacctggcggcggccgaggcgctgcgcccgttcagcgccgaggcc
ggtgagccggatgagaccgcgggcccggccgggccgccggagaacccgtacaccctccac
caggagctccagcagtcgatgaacgacctggtggggatcatccgcaaggccggggagatg
gaggaggcgctgcaccggctggccagtctgcgggtccgggcgcgccgcgccggggtcgag
ggccaccggcagttcaaccccggctggcacctggcgatcgatctgcgcaacatgctgctg
gtcagcgagtgcgtggcgcgcgccgcgctggagcggaccgagagccgcggcggacacacc
cgcgacgactgcccggagatggaccgcgaatggcggcggctcaatctggtctgccggctc
tccgacccctcgggcggtctggcgacccccgacgccgggcacggccagatccggctcgag
cggcgggagacgccgcccatccggcccgacctgctgaacctgttcgagaaggacgagctg
gtgaagtacctgacggacgaggagctgacccagtga

DBGET integrated database retrieval system