KEGG   Streptomyces rapamycinicus: M271_18465Help
Entry
M271_18465        CDS       T02907                                 

Definition
(GenBank) fumarate reductase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
src  Streptomyces rapamycinicus
Pathway
src00020  Citrate cycle (TCA cycle)
src00190  Oxidative phosphorylation
src00650  Butanoate metabolism
src01100  Metabolic pathways
src01110  Biosynthesis of secondary metabolites
src01120  Microbial metabolism in diverse environments
src01130  Biosynthesis of antibiotics
src01200  Carbon metabolism
Module
src_M00009  Citrate cycle (TCA cycle, Krebs cycle)
src_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
src_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M271_18465
   00650 Butanoate metabolism
    M271_18465
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    M271_18465
Enzymes [BR:src01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     M271_18465
    1.3.5.4  fumarate reductase (quinol)
     M271_18465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_7 Fer4_18 Fer4_17 Fer4_9 DUF1126 Fer4_16 Fer4_10
Motif
Other DBs
NCBI-ProteinID: AGP55250
LinkDB All DBs
Position
4683053..4683823
Genome map
AA seq 256 aa AA seqDB search
MSAYEAHFRVWRGDQDGGGLKDFHVEVNDGEVVLDIVHRLQATQAPDLAVRWNCKAGKCG
SCSAEINGRPRLLCMTRMSVFERNETITITPLRAFPVVRDLVTDVSFNYTKAREVPSFVP
PEGLGPGEYRMWQEDVNRSQEFRKCIECFLCQDTCHVVRDFEENKEAFAGPRFLMRVAEL
DMHPLDAAAETGLDRKSTAQEEHGLGYCNITKCCTEVCPEQIKITDNALIPLKERAADRK
YDPLVWLGNKIRRRGQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcgtacgaggcccacttccgggtgtggcggggcgaccaggacggcggcggtctg
aaggacttccacgtcgaggtcaacgacggcgaggtggtactggacatcgtccaccggctg
caggccacccaggcccccgacctggcggtccgctggaactgcaaggcgggcaaatgcggt
tcgtgcagcgccgagatcaacggccggccacggctgctgtgcatgacccggatgtcggtg
ttcgaacggaacgagacgatcaccatcaccccgctacgggccttcccggtggtgcgggac
ctggtgacggatgtgtcgttcaactacaccaaggcccgtgaggtgccgtccttcgtgccc
ccggaggggctgggtccgggcgagtaccggatgtggcaggaggatgtgaaccggtcgcag
gagttccgcaagtgcatcgagtgcttcctgtgccaggacacctgccatgtggtgcgggac
ttcgaggagaacaaggaggcgttcgccgggccgcggttcctgatgcgggtcgcggagctg
gacatgcatccgctggacgcggccgccgagaccggtcttgaccgcaagagcaccgcccag
gaggagcacggactgggctactgcaacatcaccaagtgctgtacggaggtctgccccgag
cagatcaagatcaccgacaacgcgctgatcccgctcaaggagcgggcggcggaccgtaag
tacgacccgctggtctggctcggcaacaagatccgccgccgggggcagtag

DBGET integrated database retrieval system