KEGG   Streptomyces rapamycinicus: M271_19645Help
Entry
M271_19645        CDS       T02907                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
src  Streptomyces rapamycinicus
Pathway
src00620  Pyruvate metabolism
src00680  Methane metabolism
src01100  Metabolic pathways
src01120  Microbial metabolism in diverse environments
src01200  Carbon metabolism
Module
src_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M271_19645
  09102 Energy metabolism
   00680 Methane metabolism
    M271_19645
Enzymes [BR:src01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M271_19645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AGP55476
UniProt: A0A0A0NE29
LinkDB All DBs
Position
complement(4955680..4958400)
Genome map
AA seq 906 aa AA seqDB search
MSSADHTNAALRADIRRLGDLLGETLVRQEGPDLLELVERVRALTRSDGEAAADLLGTTD
LETAAKLVRAFSTYFHLANVTEQVHRGRELRARRAAEGGILARTADQLKDADPEHLRETV
ANLGVRPVFTAHPTEAARRTVLTKLRRIAELLDTLAVGGDARRADLRLAESIDLLWQTDE
LRVARPEPADEARNAIYYLDELHAGAVGDVLEDLTAELERVGVELPATTRPLTFGTWIGG
DRDGNPNVTPEVTRDVLILQHEHGITDALEIVDELRAALSSSIRNTGASEELLASLQRDL
GLLPEISPRYKRLNAEEPYRLKATCMRQKLVNTRERLAGDTPHQPGRDYLGSGELLADLH
LVQDSLRAHRGQLIADGRLERSIRTLAAFGLQLATMDVREHADAHHHALGQLFDRLGEES
WRYADMPRDYRRKLLARELRSRRPLAPTPAPLDAAGAKTLGVFHTIRESFERFGPEIVES
YIISMCQGSDDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTEELKIADKLLDEMLADP
SYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRLLRDVAHRHGVRLRLFHGRG
GTVGRGGGPTHDAILAQPWGTLEGEIKVTEQGEVISDKYLVPSLARENLELTVAATLQAS
ALHTAPRQSDEALARWDAAMETVSEAAHGAYRTLVDDPDLPAYFFASTPVDQLAELHLGS
RPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKAAREAGLDTVLDEMHQHW
HFFRNFLSNVEMTLAKTDLRIARHYVDTLVPDELKHVFDVIQEEHELTVREVLRITGGRE
LLDSNPVLKQTFHVRDAYLDPISYLQVTLLHRQRTAAERGEDPDPLLARALLLTVNGVAA
GLRNTG
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccacaccaacgccgccctgcgtgccgacatccgccgtctgggcgac
ctgctcggcgagaccctcgtccgacaggagggacccgacctcctcgaactcgtcgagcgc
gtccgcgccctcacccgcagtgacggcgaggccgcggccgacctgctcggcaccaccgac
ctcgagaccgccgccaagctggtccgcgccttctccacctacttccacctggccaacgtc
accgagcaggtgcaccgcggccgcgagctgcgggcccgccgcgccgccgagggcggcatc
ctcgcccgcaccgccgaccagctcaaggacgccgaccccgagcacctccgggagaccgtc
gccaacctcggcgtgcgccccgtcttcaccgcccaccccaccgaggccgcccgccgcacc
gtcctcaccaagctccggcgcatcgccgagctgctcgacaccctcgccgtcggcggcgac
gcccgccgcgccgacctgcggctcgccgagagcatcgacctgctctggcagaccgacgag
ctgcgcgtcgcccgccccgagcccgccgacgaggcccgcaacgccatctactacctcgac
gagctgcacgccggagccgtcggcgacgtactcgaagacctcaccgcggagctcgagcgc
gtcggcgtcgagctgcccgccaccacccgcccgctcaccttcggcacctggatcggcggc
gaccgcgacggcaaccccaacgtcacccccgaggtcacccgcgacgtgctgatcctccag
cacgagcacggcatcaccgacgcactggagatcgtcgacgagctgcgcgccgcgctctcc
agctccatccgcaacaccggcgcctccgaggagctcctcgcctccctccagcgcgacctc
ggactgctgcccgagatcagcccgcgctacaagcggctcaacgccgaggagccctaccgg
ctcaaggccacctgtatgcggcagaagctcgtcaacacccgcgagcggctcgccggggac
accccccaccagcccggccgcgactacctcggctccggagagctcctcgccgacctccac
ctcgtccaggactccctgcgcgcccaccgcggccagctcatcgccgacggccggctcgaa
cggtccatccggaccctcgccgccttcggcctccagctcgccaccatggacgtccgcgag
cacgccgacgcccaccaccacgccctcggccagctcttcgaccggctcggcgaggagtcc
tggcgctacgccgacatgccgcgcgactaccgccgcaagctgctcgccagggaactgcgc
tcccgccgccccctcgcccccaccccggcgccgctcgacgccgccggtgccaagaccctc
ggcgtcttccacaccatccgcgagtccttcgaacgcttcggccccgagatcgtcgagtcg
tacatcatctccatgtgccagggctccgacgacgtcttcgccgccgccgtcctcgcccgc
gaggccgggctgatcgacctccacgcgggctgggccaagatcggcatcgttccgctgctg
gagaccaccgaagagctgaagatcgccgacaagctcctcgacgagatgctcgccgacccc
tcctaccggcggctcgtcgccctccgcggcgacgtccaggaggtcatgctcggctactcc
gactcctccaagttcggcggcatcaccacctcccaatgggagatccaccgcgcccagcgg
ctgctgcgcgacgtcgcccaccggcacggcgtacggctgcggctcttccacggccgaggc
ggcaccgtcggccgcggcggcggccccacccacgacgcgatcctcgcgcagccgtggggc
accctcgagggcgagatcaaggtcaccgagcagggcgaggtcatctccgacaagtacctc
gtgccctcgctcgcccgcgagaacctggagctgacggtggccgccacgctgcaggcatcc
gccctgcacaccgccccgcgtcagtccgacgaggcgctcgcccgctgggacgcggccatg
gaaaccgtctccgaagccgcacacggcgcctaccgcacgctcgtcgacgaccccgacctg
cccgcgtacttcttcgcctccacgcccgtggaccagctcgccgaactccacctcggctcc
cggccctcccgccgccccgactccggcgccgggctcgacgggctgcgggccatcccgtgg
gtgttcggctggacccagtcccggcagatcgtccccggctggttcggcgtcggctccggc
ctcaaggccgcccgcgaggccggactcgacaccgtcctcgacgaaatgcaccagcactgg
cacttcttccgcaacttcctctccaacgtcgagatgacgctggccaagacggatctgcgg
atcgcccggcactacgtcgacacgctcgtcccggatgagctgaagcatgtcttcgacgtg
attcaggaggagcacgaactgacggtgcgggaggtgctgcggatcaccggtggacgggaa
ctcctcgactccaacccggtgctgaagcagacgttccacgtccgggacgcctacctcgac
ccgatctcgtatctgcaggtgaccctgctccaccgccagcgcaccgcggccgagcggggc
gaggaccccgaccccctgctcgcccgcgccctcctcctcacggtcaacggcgtagcggcg
ggcctccgcaacacgggctga

DBGET integrated database retrieval system