KEGG   Streptomyces rapamycinicus: M271_20640Help
Entry
M271_20640        CDS       T02907                                 

Definition
(GenBank) DNA ligase
Organism
src  Streptomyces rapamycinicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AGP55672
UniProt: A0A0A0N8E6
LinkDB All DBs
Position
complement(5163317..5164219)
Genome map
AA seq 300 aa AA seqDB search
MDVALARVVPILPTAPPGRRLAYEPKFDGHRLLIFRLGDTVRMQARSGRIITRAFPDLAA
AARPLPPGTVLDGEVVVWAGGRTDFAAVQKRAFAASESRAGRLARELPASYAAFDLLAIG
AEDLRPLPYEQRRARLMALLEPLGPPLQAVPMTTDPELAATWYASLLEIGIEGLVIKELD
QPYRPGRHWRKVRHSETRDAVVVGVVGPRLRPRALALVLPGDDAPLISAPLSTAVRAQLG
TALRDLPDPQPPPAELPTALDRVGAEIAYRPIAPDLTVEVRQEGTVRHAATRVMRLRIPD
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtggcgctggcccgtgtcgtcccgatcctgcccaccgccccgcccggccggcga
ctggcgtacgagcccaagttcgacggccatcggctgctgatcttccggctgggggacacc
gtaaggatgcaggcccgctccggccgcatcatcacccgcgccttccccgacctggcggcc
gccgcgcggccgctgccgcccggcacggtcctcgacggcgaggtggtggtgtgggcgggc
ggccgtacggacttcgccgccgtccagaagcgcgccttcgccgcgtccgagtcccgggcg
gggcggctcgcccgggaactgcccgcctcctacgccgccttcgacctgctcgcgatcggc
gcggaggatctgcggccgcttccgtacgaacagcgccgcgcccggctgatggcgctcctc
gaaccgctcggcccaccgctccaggccgtgccgatgacgactgatccggagctcgccgcc
acctggtacgcgtcactcctggagatcggtatcgagggcctggtcatcaaggagctggac
cagccctaccggccgggccgccactggcggaaggtgcgccactcggagacccgtgacgcc
gtggtcgtcggcgtcgtcggcccccgcctccgcccgcgcgccctcgcgctggtgctcccc
ggcgacgacgcgcccttgatctccgccccgctctccacggccgtccgcgcccagctcggc
acggccctgcgcgacctgcccgacccccagcccccgcccgccgaactccccaccgccctg
gaccgcgtcggcgccgagatcgcctaccgccccatcgccccggacctgaccgtcgaggtc
cgccaggaaggcacggtccgccacgcggcgacgagagtcatgcgcctccgcatccccgac
tga

DBGET integrated database retrieval system