KEGG   Streptomyces rapamycinicus: M271_22550Help
Entry
M271_22550        CDS       T02907                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
src  Streptomyces rapamycinicus
Pathway
src00330  Arginine and proline metabolism
src01100  Metabolic pathways
src01110  Biosynthesis of secondary metabolites
src01130  Biosynthesis of antibiotics
src01230  Biosynthesis of amino acids
Module
src_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    M271_22550
Enzymes [BR:src01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     M271_22550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 NAD_Gly3P_dh_N Shikimate_DH ApbA TrkA_N PDH GFO_IDH_MocA IlvN
Motif
Other DBs
NCBI-ProteinID: AGP56025
LinkDB All DBs
Position
complement(5657474..5658283)
Genome map
AA seq 269 aa AA seqDB search
MTEKVAVLGTGKIGEALLSGMIRGGWSPSDLLVTARRPERAEELRSRHGVEAVSNAEAAK
AAETLILTVKPQDMGALLDELAPHVPADRLVVSGAAGIPTSFFEARLAAGTPVVRVMTNT
PALVDEAMSVISAGSHATEEHLAHTEAIFGGVGKTLRVPESQQDAATALSGSGPAYFYFL
VEAMTDAGILLGLPRDKAHDLIVQAAIGAAVMLRDSDQHPVKLREAVTSPAGTTINAIRE
LESHGVRAALIAALEAARDRSRELASGNS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacggagaaggtcgccgtgctcggcacgggaaagatcggcgaagcccttctcagcgga
atgatccgaggtggctggtcgccgtccgacctgctggtcaccgcccgccgccccgagcgc
gccgaggagctccggtcgcgccacggcgtcgaggccgtctccaacgccgaggccgccaag
gccgccgagaccctcatcctcaccgtcaaaccgcaggacatgggcgccctgctcgatgag
ctcgccccgcacgtccccgccgaccggctggtcgtctccggcgccgccggcatccccacc
tccttcttcgaggcgcgcctggccgccggcaccccggtcgtccgggtcatgaccaacacc
ccggcgctggtcgacgaggccatgtccgtcatctcggcgggcagccacgccaccgaggag
cacctcgcccataccgaggcgatcttcggcggcgtcggcaagacgctccgcgtccccgag
tcccagcaggacgccgcgaccgcgctctccggctccggcccggcctacttctacttcctc
gtcgaggcgatgaccgacgcgggcatcctgctgggcctgccccgcgacaaggcccatgac
ctgatcgtccaggcggccatcggcgcggccgtgatgctgcgcgacagcgatcagcacccg
gtcaagctgcgcgaggccgtgacctccccggcgggcaccaccatcaacgccatccgcgaa
ctggagagccacggggtgcgcgccgcgctgatcgccgcgctggaggcggcccgcgaccgc
agccgcgagctcgcctccggcaacagctga

DBGET integrated database retrieval system