KEGG   Streptomyces rapamycinicus: M271_27055Help
Entry
M271_27055        CDS       T02907                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
src  Streptomyces rapamycinicus
Pathway
src00250  Alanine, aspartate and glutamate metabolism
src00410  beta-Alanine metabolism
src00430  Taurine and hypotaurine metabolism
src00650  Butanoate metabolism
src01100  Metabolic pathways
src01110  Biosynthesis of secondary metabolites
src01120  Microbial metabolism in diverse environments
src02024  Quorum sensing
Module
src_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M271_27055
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M271_27055
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M271_27055
   00430 Taurine and hypotaurine metabolism
    M271_27055
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    M271_27055
Enzymes [BR:src01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     M271_27055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGP56881
UniProt: A0A0A0NI60
LinkDB All DBs
Position
complement(6619575..6620846)
Genome map
AA seq 423 aa AA seqDB search
MAPTTAYQFVHDELMLDGNARQNLATFVTTWMEPQAGRLMSDCFAKNMIDKDEYPRTAEL
ERRCVTMLGHLWHAPDPDAVVGCSTTGSSEACMLAGMAFKRRWAKRNPVSYPATARPNLV
MGTNVQVCWEKFCDFWEVEARQVPMEGDRYHLDPRAAAELCDENTIGVVAVLGSTFDGSY
EPVAEVCRALDDLQERTGLDIPVHVDGASGAMVAPFLDPDLVWDFQLPRVASINTSGHKY
GLVYPGVGWALWRTADALPEELVFRVDYLGGNMPTFSLNFSRPGSQVAAQYYTFVRLGRE
GYRAVQQQTRDVARSLAERIEAFGDFTMLSRGDQLPVFAFTTAEGIRGFDVYDVSRRLRE
RGWLVPAYTFPPNREDLSVLRVVCRNGFSEDLADLFLGDLGSLLPELRSQSAPMGKVVKA
FHH
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccacgacggcgtatcagttcgtccatgacgagctgatgctggacggcaacgcc
cgccagaacctcgccacgttcgtcaccacgtggatggagccgcaggcgggccggctgatg
tccgactgcttcgccaagaacatgatcgacaaggatgagtatccgcgcaccgccgaactg
gagcggcggtgcgtgaccatgctcggccatctgtggcacgcccccgacccggacgcggtc
gtgggctgctccaccacggggtcgagcgaggcgtgcatgctggccggaatggccttcaag
cggcgctgggccaagcggaacccggtgagctatccggccaccgcccggcccaatctggtc
atgggcaccaatgtccaggtgtgctgggagaagttctgcgacttctgggaggtggaggcc
cggcaggtgcccatggagggcgaccggtaccacctcgatccccgggccgccgccgagctg
tgcgacgagaacaccatcggggtcgtcgcggtcctcggctccaccttcgacggctcctac
gaacccgtcgccgaggtgtgccgggcgctggacgacctccaggagcgcacgggcctggac
atcccggtgcacgtggacggcgcctcgggcgcgatggtcgcgccgttcctcgacccggac
ctggtgtgggacttccagctgccgcgggtcgcctccatcaacacctcgggccacaagtac
ggcctggtctaccccggggtgggatgggcgctgtggcgtacggcggacgcgctgcccgag
gagctggtcttccgcgtcgactacctcggcggcaatatgcccacgttctcgctcaacttc
tcccgccccggctcccaggtggccgcccagtactacaccttcgtacggctgggccgggag
ggctaccgcgccgtccagcagcagacccgcgatgtggcgcgctcgctcgccgagcggatc
gaggcgttcggggacttcaccatgctcagccgcggcgatcagctgccggtgttcgcgttc
accacggcggaggggatccgcggcttcgacgtctacgacgtctcccggcggctgcgcgaa
cgcggctggctggtgcccgcgtacaccttcccgcccaaccgggaggacctgtccgtactg
cgggtggtgtgccgcaacggcttctcggaggacctcgccgatctcttcctgggcgacctg
gggtcgctgctgccggagctgcggtcacagtccgcgcccatggggaaggtcgtcaaggcg
ttccatcactga

DBGET integrated database retrieval system