KEGG   Streptomyces rapamycinicus: M271_34055Help
Entry
M271_34055        CDS       T02907                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
src  Streptomyces rapamycinicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AGP58225
UniProt: A0A0A0NTX4
LinkDB All DBs
Position
8371593..8373059
Genome map
AA seq 488 aa AA seqDB search
MNDLIEHGQLFIGGALADPAGEDTIEVVSPHTEQVIGRVPHASRADVDRAVAAARTAFDE
GPWARTSLDERIAVVTRIKDAIAVRHEEIARVISAQNGSPYSWSVLAQALGAMMVWDSAI
TVARDFVYEERRAGVLGPLLVRREPVGVVAAVVPWNVPQFVAAAKLAPALLAGCSVILKP
SPETPLDSYILAEIATGAGLPEGVLSILPADREVSEYLVGHPGVDKVSFTGSVAAGKRVM
EVASRHLTRVTLELGGKSAAVILPDADLEAAVTGIVPNAWMNNGQACVAQTRILAPRARY
DEIAERFAAAASALVVGDPLDPATQVGPLVARRQQRRSLDYIALGQREGAKVLTGGGRPE
AQRTGWYVEPTLFGDVGNDMRIAREEIFGPVICLLPYGDEEEAARIANDSDYGLSGSVWT
ADVGHGIDFARRVRTGTYSVNTFSLDMLGPFGGYKNSGLGREFGPEGFSAYLEHKMIHLP
QGWDGEPS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctcatcgagcacgggcagctcttcatcggcggcgcgctggccgatccggcg
ggcgaggacaccatcgaggtcgtctcgccgcacaccgaacaggtcatcgggcgggtgccg
cacgcctcccgcgccgatgtggaccgggccgtcgcggcggcgcggacggcgttcgacgag
ggcccctgggcccggacgagcctggacgagcggatcgcggtggtcacccggatcaaggac
gccatcgccgtacgccatgaggagatcgcccgggtcatcagcgcgcagaacggctccccg
tactcctggagcgtcctcgcccaggcgctcggcgcgatgatggtgtgggactcggccatc
accgtggcccgcgacttcgtctacgaggagcggcgggccggggtgctcggcccgctgctg
gtgcggcgggagccggtcggggtggtcgcggccgtggtgccgtggaacgtaccgcagttc
gtggcggccgcgaagctggcgcccgcgctgctcgcggggtgctcggtgatcctcaagccg
tcgcccgagacaccgctggactcctacatcctggcggagatcgcgaccggggcggggctg
cccgagggggtgctgtcgatccttccggccgaccgcgaggtcagcgagtacctggttggc
cacccgggcgtggacaaggtgtcgttcaccggctcggtcgcggccggaaagcgggtgatg
gaggtggcctcgcgccatctgacccgggtcacgctggagctgggcggcaagtcggccgcg
gtgatcctgccggacgcggacctggaggcggccgtcaccgggatcgtgcccaacgcctgg
atgaacaacggacaggcgtgtgtggcccagacccggatcctcgcgccgcgcgcccgctac
gacgagatcgccgagcggttcgcggccgccgcctccgccctggtcgtcggcgacccgctg
gatccggccacccaggtcgggccgctggtggcgcggcggcagcagcgccggtcgctggac
tacatcgcgctggggcagcgggagggcgccaaggtgctgaccggcggcggccgtccggag
gcccagcggaccggctggtacgtggagcccacgctcttcggcgacgtcggcaacgacatg
cggatcgcccgtgaggagatcttcggcccggtgatctgtctgctgccgtacggggacgag
gaggaggcggcccggatcgccaatgactccgactacgggctgtccggctccgtctggacg
gcggacgtcgggcacggcatcgacttcgcacggcgcgtccgcaccggcacctactcggtc
aacaccttcagcctcgacatgctcgggccgttcggcggctacaagaactccggtctgggc
agggagttcggcccggaggggttctccgcgtatctggagcacaagatgatccacctgccc
caggggtgggacggggagccgagctga

DBGET integrated database retrieval system