KEGG   Streptomyces rapamycinicus: M271_46360Help
Entry
M271_46360        CDS       T02907                                 

Definition
(GenBank) hypothetical protein
Organism
src  Streptomyces rapamycinicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 Ketoacyl-synt_C KR KAsynt_C_assoc PS-DH PP-binding adh_short PKS_DE Thiolase_N Epimerase Polysacc_synt_2 GDP_Man_Dehyd Docking SAT NmrA RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AGP60637
UniProt: A0A0A0NM24
LinkDB All DBs
Position
11527720..11544663
Genome map
AA seq 5647 aa AA seqDB search
MSEQEKLLGYLRRVTADLHQTRQRLQDVESAAREPIAIVGMSCRFPGGVRSPEEFWRLLS
GAEDGITPFPDDRGWNLGPLYDADPDRPGTSYAREGGFLYDVGDFDADFFGISPREALAM
DPQQRLLLETSWEAVERAGIDPASLRGSRSGVFVGAVAPDYGPRVHEATDGVEGHLVTGS
AISVVSGRVAYTLGLEGPAVTVDTACSSSLVALHLAVQALRQGECSLALAGGVTVMATPG
TFIGFSRQRGLAPDGRCKPFAAAADGFGPAEGVGMLFLERLSDAHRNGHPVLAVVRGTAT
NQDGASSALSAPNGPSQQRVIRQALANAGLTAGQVDAVEAHGTGTKLGDPIEAQALLATY
GRERATGHPLLLGSVKSNIGHTQAAAGVAGVMKMVLAMRHGVLPRTLHIDEPSPHVDWTA
GTVELLTEATAWPEGEEPRRAGVSSFGISGTNAHAIIEQAPPPAATDATSDAVSDAASGA
DVAEEAAVPRAALPLVPWPLSSKSASVLRSQATRLLDHVERHPEVTAEDIGLSLATTRTA
FEHRAVVLAPDRAEAVRTLAEHLAGRCASGLVEGVAKRSAGVAFVFPGQGSQWVGMAAGL
LDSAPVFARRMEECAAALAPFVDWSLVDVLRDPAALERVDVVQPALFAVMVSLAELWRSY
GVEPSAVIGHSQGEIAAACVAGALSLEDAARVVALRSRALRALSGRGGMASVSLPVERVR
ERLAAWGERLSVAAVNGPSAVVVSGDADALDELLAACEAEEIRARRVPVDYASHSVHVES
IEDEIRRTLAGIAPRSSSVPFYSTVTGGVLDTTELNAGYWYRNLRTTVRFDETVRVLLGE
GFQTFVEASAHPVLTMGIEQTADDHGTPVAAIGSLRRDEGGPDRFLTSLAEAHVGGIAID
WRTVFAGTGAHPVELPTYAFQHQRYWLTSATTARPTGSAPAEDGADTHFWQAVEREDTEA
LAAALQVQSTEQHASLGTVLPALAQWRRQRRSESTVDEWRYRVIWRPKSGTPAASLPGPW
LLLAPSSRPGDPLVTASREALAAHGADVVLVELGADDAHRATVAERLRAATAGHPLDTLS
GVLSLLPLDERPYPAHPVATTGLTLTLALIQALDDLGVRAPLWCATQGAVSIGSSDPLTS
PAQAAVWGLGRVAGVEYPDSWGGLIDLPRTMDARAGARFAGVLADGGPEDQAAIRASGVM
LRRLEPAPLGNTPARRTWKPRGTVLITGGTGALGSRLARWLAHNGAEHLVLTSRRGLAAP
GAEDLVAELAEQGTRVTVAACDVADRAALQRVLASVPDDRPLTAVIHAAAYIDLAGLGAT
TSAEFAQVMDAKVAGAAHLDELLGDTPLDAFVLFSSVSGLWGVGDHGAYAAANAYLDALA
ERRRANGLTATSVAWGVWDATGDNMPEALDLDQLRRRGLRFMDPELGIAALRQTLDHDQT
HLAIADIDWENFIPVFTSARPSPLLDELPAMRRIQEGTDPAGAVTNASADASSGLRQRLT
GLTPAEREHTVLELVRAQVVSVLGHATSDAVDSERAFKDLGFDSLTAVELRNRLNAATGL
RLPATLAFDYPSTAVLSDHILTELTGTTADEADAPALPQTAARAETSRTVPVDPDDDPIA
IVAMSCRYPGGVSSPDELWQLVMSGGDAIGGLPTDRGWDIEAIYDPDPDAPGRTYVREGG
FLYGAGHFDPAFFGISPREALAMDPQQRLLLETSWEAFERAGMPALALRGSRTGVFIGSN
YQEYGPRVHEAPEGSEGHLMTGSAASVVSGRVAYAFGFEGPAVTVDTACSSSLVALHLAA
QALRNGECSLALAGGVAVMPNPGALIGFSRQRGLAPDGRCKAFAGAADGMGLAEGVGVLL
LERLSDARRNGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRAALRSARLSAAEVDA
VEAHGTGTKLGDPIEAQALLATYGQERTAQDRPLWLGSVKSNIGHTQAAAGVAGVMKMVL
AMRHGVLPQTLHVDEPSPHVDWSAGAVELLTDAVEWPETDRPRRAGVSSFGISGTNAHVI
LEHLAEELPVAEPVTDAPEESALVPWVVSAKSEGALRAQAERLLPYARGEAGAEASPADV
ALSLLTTRSALDERAVVLAGDGAGFAAGLRALVDGVPAAGVVRGSVVPGKLAVLFSGQGS
QRVGMGRELYEAFPVFADAFDEVCALFDVELERPLRDVVFGDVAGLDETGFTQCGLFAVE
VGLFRLVESWGVRPDFVAGHSIGELVAACVAGVLSLKDACVLVAARGRLMQGLPSGGVMV
SVQAAEADVLPLLAGREAEVSVAAVNGPYSTVISGAEEAVVEIAGLLGADGVKTKRLRVS
HAFHSPLMEPMLAEFRRVAEGLSYAPPRVPVVSNVTGLVADAEALCSAEYWVRHVRETVR
FADGVECLAGQGVVSYLELGPDGVLSGMGQECVPDAVFAPVLRGGWEETASVMEGLAQIH
VRGRAVDWAALLAPARPRAVELPTYPFQREHFWLESSVPTAETGPTDAVDADFWDAVERE
DLPALRDTLAVADENGAGESLAAVLPVLSSWRRRGRERATVDGWRYRVSWSPMSDGAGTV
TGPWLVAVPAGMTADPWVSACADALAGRGARPVMVELGPDDADRELVAARLRAALDGAEA
AAAAGVLSLLALAGGRHGRHRSVPLGVALTLSLVQAVGDVGVAAPVWCATRGAVAVAGSE
GVRTVEQAAVWGLGRVAGLEVPERWGGLLDLPEAWDARVADRLADVVSGRTGESEVAVRG
SGLFARRIVRASGGGHGVGGWVPSGTVLVTGGTGALGARVARWLACAGAEHLLLVSRRGS
EAAGVDELCAELREIGAGVTVVACDVGDRDALAGVLAGVPEELPLTGVVHAAGVLDDGVL
DGLSVERFEGVLRAKSEAAWHLHELTRGLDLSAFVLFSSFSGMVGAAGQANYAAANATLD
ALAEWRRGAGLPATSVAWGPWADNGMAVSSAEVSRTIRRNGMTAMDPRLALAALERAVTH
PDAALAVVDADWERFADTFEARRLSRLLSGVPEVRKLTATARPGDTDPAHTEESSALVRR
LETLSEAERQRALLELVRAHVAAVLGHSGVDAIGPGRAFMEIGFDSLTAVGLRNQLSEAT
GVQLPATLVFDYPTPNALAGYLLTELLGGHARPDGAPTDAATTASAAADEPIAIVSMSCR
FPGDVRSADDLWRLLAAGEDAVSAFPTDRGWDLDGLYDTDPDAIGKSYVREGAFLSEVSG
FDASFFGISPREALAMDPQQRLLLETSWELWERAGIDPEAVRGSRTGVFMGTNGQEYVSL
VDRAPETTEGYVATGNAASVVSGRISYTFGFEGPAVTVDTACSSSLVALHLAAQALRQGE
CSLALAGGVSVMVSPRGFVEFSRQRGLAPDGRCKPFAAAADGTAWGEGVGMLLLERLSDA
RRNGHQILAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALANAGLPAGQVDVVEAHGTG
TTLGDPIEAQALLATYGREHTDDQPLWLGSIKSNIGHTQAAAGVAGLIKVVLAMRHGLLP
GMPNVDEPSPYVDWSPGTVQLLTDATPWPETGRPRRAGVSSFGVSGTNAHVILEQAPSPR
PELERAAVGMPAGDLGRLPVTPWPVSGKSEAALRTQADRLLAHVRERAELSADDIGLSLA
TTRSAFEHRAVVLAGDRAGLVDGVAALAEDRDASGLIRGVAGADGRAVLVFPGQGSQWVG
MAAGLLESSPVFAGRIGECAAALAPFVEWSLGDVLRGGEGAAVALERVDVVQAVLWAVMV
SLAELWRSYGVEPAAVIGHSQGEIAAACVAGALSLEDAARVVALRSKALRALSGLGGMVS
VSLPVDSVRERLGRWGERLSVAAVNGPSAVVVSGDADALDELLAACEADEVRARRVPVDY
ASHCAHVEDIEGELLRELAGIAPRPSSVPFYSTVTGGALDTADLDAAYWYRNLRHTVRFE
ETVRALLADGFDTFIEASAHPVLTMGVEQTAEDHGARVTAVGSLRRDEGGLDRFLTSLAE
AYVGGASVDWAGLFAGTGARRVDLPTYAFQHQRFWVEPSAVAGDVSSAGLVSTDHPLLGA
AVALPEFGGQLFTGRLSLRTHPWLADHTIRGTALLPGSALVELVLRAGDAVGCGHVEELT
QETPLALPESGAVQLQLTVGGPDDSGRRTVNLYSRFEDGPPDLSWTHHATGVLATEGPTA
PTETGLGQWPPADASPMDLGDRYPSAAALGGVEYGPAFRALRHAWRRGAEIFAEVALAED
MRPEAGRFGLHPVLLDAALHAAAELTADDGGRVRLPYRWTGMSLYATGATTLRVRLSTER
PDGMAILLADESGHAVADVDAVATRTFTSEQLTGGRRPHESLFRVEWMSVPAASAGVEPD
RAHWSIVGPDGAGLRTALGTSGGRIDEYDDMGALLRPDASAAAVPDLVLLPFLTDSATDP
VAAEDDLVSATRQATHRALDVLQAWLAEERCADSRLVVVTRGAVAAVAGEDVPDTAAAAV
WGLVRSAQAEHPDRFVLVDLESLEWAAEAIGAAVATGEPQIAVRGGGAYAPRLTRALVPV
APQREPVWEPDGSVLITGASGVLGGLVARHVAARHGVRSVVLVSRRGRDAAGAAELEAEL
ADIGARVVFEACDVADREALAGVLARIPADRPLRGVVHAAGVLDDGLVESLTPERIDAVL
RPKADAAVHLDELTRDLELSAFVMFSSAAATFGAAGQGNYAAANMFLDALAARRRARGLA
GVSLAWGFWAERSDMTGHLGEVDMARMARFGMTPLTADEGLALFDAAHTTDDTLLVPTRM
DVAVLRAHARPGTTPALLRHLIGAPARRVIDAATDDLGGATALVRRLMDLPRSGREEVLL
ELVTDHAGAVLGHTESDAIAPDRAFSDIGFDSLTAVELRNRLNAATGLRLPATLVFDYPT
PTAVARHILGEVMGSARAEAETPALDRTRATPSARHAVTDDEPIAIVGMGCRFPGGVRTP
EELWQLLISGGDAIAGLPDDRGWDLEGLYHPDPDHRGTAYAREGGFLYDAGDFDPAFFGI
SPREALAMDPQQRLLLETSWEALERAGIDPASVRGSQTGVFCGLTYHDYTDAVQQAGEAT
EGYLMTGNAGSVASGRISYTFGFEGPAVTVDTACSSSLVALHWAAQALRQGECSLALAGG
ATVMASPLAFVEFSRQRGLAPDGRCKPFAGAADGTGWAEGVGMLLLERLSDARRNGHQVL
AVVRGSAINQDGASNGLTAPNGPSQQRVIRAALESARLSAAEVDAVEAHGTGTRLGDPIE
AQALLATYGQERAAEGWPLWLGAIKSNIGHAQAAAGVAGVMKMVLAMRHGVLPQTLHVDE
ASPHVDWSAGAVELLTHAVEWPETGRPRRAGVSSFGISGTNAHVILEHAPEELPVVGPVT
DGSAGSTLVPWVVSAKSEGALRAQAERLLSYARGQAGAETSVADVASSLVTTRSAFEHRA
VVLAADRAGLVDGLKALSSGDLAPGVVQGSAVPGKLAVLFSGQGSQRVGMGEGLYEAFPV
FAEAFDEVCAWFDGVLEXXXXXXXXXGSGRQDQAAAGLACLPFTPDGADAGGVPAGGRGV
VVRASAHPRRIERDGPRRGRRCAVLGRVLGAPRSRDRALRGRCREPGRRGSRHLPGARPG
RGSVHDG
NT seq 16944 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaacaagaaaagctgctcggttacctccggcgggtgacggctgatctgcaccag
acacggcagcggctgcaggacgtggagtccgcggcccgcgagccgatcgcgatcgtcggg
atgagctgccgcttccccggcggggtgcgctcccccgaggagttctggcggctgctgagc
ggggccgaggacggcatcacaccattccccgacgaccgcggctggaacctcggcccgctc
tacgacgcggaccccgaccggcccggcacctcctacgcgcgcgagggcggattcctgtac
gacgtcggcgacttcgacgccgacttcttcggtatctcgccgcgtgaggcgctggcgatg
gacccccagcagcggctgctgctggaaacttcatgggaggccgtcgagcgggcgggcatc
gacccggcctcgctcaggggcagccggtccggagtgttcgtcggggccgtggcccccgac
tacgggccgcgggtgcacgaggccaccgacggcgtcgagggccacctggtgaccggcagc
gccatcagcgtcgtatccgggcgcgtggcctacaccctgggcctggagggcccggccgtg
acggtggacaccgcgtgttcctcgtcgctggtcgccctgcacctggccgtacaggccctg
cgccagggggagtgctccctcgccctggccggtggcgtcaccgtcatggccacgcccggt
accttcatcggcttcagccggcagcgcggactcgcacccgacgggcggtgcaagcccttc
gcggcggcggccgacggtttcgggcccgccgagggcgtcggcatgctgttcctggagcgg
ctctccgacgcacaccgcaacgggcaccccgtgctggccgtcgtccggggcacggcgacc
aaccaggacggcgcgagcagcgcgctctccgcccccaacggcccgtcccagcagcgggtg
atccgccaggcgctggccaacgccggactcacggccgggcaggtcgacgccgtcgaggca
cacgggacgggaaccaagctgggcgacccgatcgaggcacaggcactgctggccacctac
ggccgtgagcgcgccacgggccacccgctgctgctggggtcggtcaagtcgaacatcgga
catacgcaggcggcggccggtgtggccggtgtgatgaagatggtgctggcgatgcggcac
ggagtgctgccccgcaccctgcacatcgacgagccgtccccgcatgtggactggacggcg
ggcaccgtcgaactcctcaccgaggccaccgcgtggcccgagggtgaggagccgcgccgg
gccggtgtgtcctcgttcggcatcagcggcaccaacgcccacgccatcatcgagcaggcg
ccgccaccggccgctaccgatgccacttccgacgccgtttccgacgccgcttccggtgcg
gacgtggcggaggaagcggcggtgccccgggcggcgctcccgctcgtcccctggccgctg
tccagcaagtccgcatcggtgctgcgctcccaggcgacgcggctgctggaccacgtggag
cggcacccggaggtcacggccgaggacatcggactgtccctcgccaccacgcggaccgcc
ttcgagcaccgcgcggtcgtgctggccccggaccgtgcggaagccgtacggaccctggcc
gaacacctcgcgggccggtgcgcctccgggctggtcgaaggcgtcgccaagcgcagcgcc
ggagtcgccttcgtcttccccggccaggggtcgcagtgggtgggcatggcggccggactg
ctggattccgcgccggtgttcgcccggcggatggaggagtgtgcggcggcgttggcgccg
ttcgtggactggtcgctggtggatgtgctccgcgaccccgcggcgctggagcgggtggat
gtcgtacagcccgccctgttcgcggtgatggtgtcgctggcggagctgtggcgttcgtac
ggcgtggagccgtcggccgtcatcggccattcgcagggtgagatcgcggcggcgtgtgtg
gcgggtgcgttgtcgctggaggatgccgcgcgcgtggtggccctgcgcagccgcgccctg
cgcgcgctgtccgggcgcggtggcatggcgtcggtgtcgctgcccgtggagcgcgtacgg
gagcggctcgcggcatggggcgagcggctgtcggtggcggcggtgaacggcccgtcggcg
gtcgtggtctccggcgacgcggacgcgctggacgagttgctggcggcgtgcgaggcggag
gagatccgggcgcgccgcgtacccgtggactacgcctcgcactccgtccacgtcgagagc
atcgaggacgagatccggcgcaccctcgccgggatcgctccgcgctcctcatcggtgccg
ttctactccacggtgaccggcggcgtgctggacaccacggagctgaacgccggctactgg
taccgcaatctgcgtacgacggtgcgtttcgacgagaccgtacgagtgctcctcggcgag
ggattccagacgttcgtggaggccagcgcgcatccggtgctcaccatgggcatcgagcag
acggccgacgaccacggcacccccgtggcggccatcggctcgctgcgccgcgacgaaggc
ggcccggaccggttcctgacctccctggccgaggcgcacgtcggcggcatcgccatcgac
tggcggacggtgttcgccggaaccggcgcgcaccccgtcgagctgcccacctacgccttc
cagcaccagcgctactggctcacctcggccaccaccgcgcgccccaccgggagcgccccg
gccgaagacggcgcggacacgcacttctggcaggccgtggagcgcgaggacaccgaggcg
ctggccgccgcgctccaggtccaatccaccgagcagcacgcctcgttgggcaccgtcctg
cccgccctcgcacagtggcgtcggcagcggcgctccgaatcgaccgtggacgagtggcgc
taccgcgtgatctggcgccccaagagcggcaccccggccgcctcgcttccggggccatgg
ctgctgctggcccccagctcccgccccggcgacccgctggtcacggcctcccgcgaggca
ctcgcggcacacggcgccgatgtcgtcctggtcgagctgggcgcggacgacgcacaccgc
gccacggtggccgagcggctgcgcgccgccaccgccggccacccgctggacacgctgtcc
ggcgtgctgtcactgctgccgctcgacgaacgcccgtaccccgcacatcccgtggccacc
accggcctgaccctgaccctcgccctgatccaggccctcgacgacctcggtgtccgggcg
ccgctgtggtgcgccacccagggcgcggtgtccatcggcagctccgatccgctcaccagc
cccgcccaggcggcggtgtggggcctgggccgggtggccggagtggagtacccggacagc
tggggcgggctgatcgacctgccgcgcaccatggacgcccgggccggggcccggttcgcc
ggagtgctcgcggacggcggccccgaggaccaggccgcgatccgcgcctcgggggtgatg
ctgcggcggctcgagcccgcacccctcgggaacacccccgcgcggcgcacctggaagccc
cgtggcacggtcctcatcaccggtggcaccggcgccctcggcagccgtctggcccggtgg
ctggcgcacaacggcgccgaacacctggtgctgaccagccgccgcgggctcgccgccccc
ggcgccgaagacctggtcgccgaactggccgaacagggcacccgggtcaccgtcgccgcc
tgcgacgtggcggaccgcgccgcgcttcagcgcgtcctcgcgtccgtacccgacgaccgg
ccgctcaccgcagtcatccacgccgcggcatatatcgacctggccggtcttggcgcgacg
acctcggcggagttcgcccaggtcatggacgcgaaagtggcgggcgcggcccatctggac
gagctgctgggcgacaccccgctggacgcgttcgtgctgttctcctcggtgtccgggctg
tggggcgtcggcgaccacggcgcgtacgccgccgccaacgcctacctggacgcgctcgcc
gagcggcggcgggcgaacggcctgacggcgacctcggtggcctggggagtgtgggacgcc
accggcgacaacatgcccgaggccctggacctggaccagttgcggcggcgtggactgcgg
ttcatggaccctgagctcggcatcgccgcgctccggcagacgctcgaccacgaccagacc
cacctggccatcgccgatatcgactgggagaacttcatcccggtcttcacctccgcccgc
cccagcccgctgctggacgaactgcccgcgatgcgacggatccaggagggcaccgacccc
gccggggcggtcacgaacgcgtcggccgacgcctcgtcgggcctgcggcagcggctgacc
ggactgacccccgccgagcgtgagcacaccgtcctggagctggtgcgcgctcaggtggtt
tccgtcctgggacacgccacctcggacgcggtggattccgaacgcgcgttcaaggacctc
ggcttcgactcgctgacggccgtcgaactgcgcaaccggctcaacgcggccaccgggctg
cgcctgcccgccacgctggccttcgactaccccagcaccgccgtcctgagcgaccacatc
ctcaccgagctgacgggcacgacggccgacgaggcggacgcccccgccctcccgcagacg
gcggcgcgggcggaaacgtcccggaccgtgcccgtggaccccgacgacgaccccatcgcc
atcgtggcgatgagctgccgttatccgggtggggtgtcctcgcccgatgagctgtggcag
ctcgtcatgtccggcggtgacgcgatcggcgggctgcccaccgaccgtggctgggacatc
gaggccatctacgacccggacccggacgcgccgggcaggacgtatgtgcgcgaaggcggt
ttcctctacggcgcgggccacttcgacccggcgttcttcggtatctcgccgcgtgaggcg
ctggcgatggacccccagcagcggctgctgctggagacctcgtgggaagcgttcgagcgc
gccggtatgcccgcgctcgcgctgcgcggcagccgcaccggcgtcttcatcggctccaac
taccaggagtacggaccgcgggtacatgaggcgcccgagggctccgaaggccacctgatg
acgggaagcgcggccagcgtcgtgtccggacgtgtcgcgtacgccttcggcttcgagggc
cccgcggtgacggtggacaccgcgtgctcctcgtccctggtggcgctgcacttggcggcg
caggcactgcggaacggggagtgctccctggcgctcgccggtggcgtcgccgtcatgccg
aaccccggcgccctcatcggcttcagccgccagcggggcctggcgcccgacggccgttgc
aaggcgttcgcgggggccgcggacggcatggggctcgcggagggcgtcggcgtgctgctg
ctcgagcggctgtccgacgcgcggcggaacggtcaccgggtgctggccgtggtgcggggc
agcgcggtcaaccaggacggtgcgtcgaacggcttgacggcgccgaacggcccgtcgcag
cagcgggtgatccgggcggcgctgcggagtgctcggttgtcggctgctgaggtggacgcg
gtcgaggcgcatggtacgggtacgaagctgggcgatccgattgaggcgcaggcgctgctg
gcgacgtacggccaggagcggacggcccaggaccggccgctgtggctggggtcggtgaag
tccaacatcggccatacgcaggccgccgccggcgtcgcgggcgtgatgaagatggtgctc
gccatgcggcacggtgtgctgccgcagacgctgcacgtggatgagccgtcgccgcatgtg
gactggtcggctggtgcggtggaactgctgacggacgcggtggagtggccggagaccgat
cggccgcggcgtgccggtgtgtcgtcgttcgggatcagtggcaccaacgcacacgtcatc
ctggaacacctcgccgaggaactgcccgtcgccgagccggtgaccgacgcgcctgaggag
tcggcgctggtgccgtgggtggtgtcggcgaagtccgagggtgcgctgcgggcgcaggcg
gagcgattgcttccctacgcccggggtgaggccggggcggaggcgtcgccggctgatgtg
gcgttgtcgctgctcacgacgcggtcggccctcgatgagcgggccgtggtgctggcgggc
gacggtgcggggtttgccgccgggttgcgggcgctggtggatggcgtaccggcggcgggt
gtggtgcgcggatcggtggtgccggggaagctggcggtgctgttctcggggcagggcagt
cagcgggtcgggatgggccgggagctgtatgaggcgttcccggtcttcgcggacgcgttt
gacgaggtgtgtgccctgttcgacgtggagttggagcggccgctgcgggatgtggtgttc
ggggatgtggcggggctggatgagacggggtttacgcagtgtgggttgttcgcggtggag
gtggggctgttccggttggtggagtcgtggggtgtgcggccggattttgtggcggggcat
tcgattggtgagttggtggcggcgtgtgtggcgggtgtgttgtcgctgaaggacgcgtgt
gtgttggtggcggctcgtgggcggttgatgcaggggttgccgtcgggtggggtgatggtg
tcggtgcaggccgccgaggccgacgtactgccactgctggccggtcgtgaggccgaggtg
agtgtggcggcggtcaacggtccgtactcgaccgtgatctccggcgcggaagaagctgtg
gtggagattgccgggctgctgggggccgatggcgtcaagaccaagcggctgcgggtctcg
cacgcgttccattcacccttgatggagccgatgctggcggagttccggcgggtggccgag
gggttgtcgtacgcgcctccccgcgtccccgtcgtatcgaacgtgacgggactggtggcg
gacgccgaggcgctgtgctcggccgagtactgggtgcggcacgtccgcgagaccgtgcgg
ttcgcggacggtgtggagtgcctggccgggcaaggcgtagtcagttacctggagttgggc
cccgacggagtcctctccgggatggggcaggagtgtgtgccggacgccgtcttcgcccct
gttcttcgcggcggctgggaagagaccgcctcggtcatggaggggctggcccagatccat
gtgcggggccgcgccgtggactgggccgccctgctcgcaccggcgcgcccccgggccgtc
gagctgcccacgtaccccttccagcgggagcacttctggctggagtcgtccgtccccacg
gctgagacgggccccacggacgcggtggacgccgacttctgggacgcggtggagcgtgag
gatctgcccgcgctcagggacacgctggcggtcgcggacgagaacggtgccggtgagtcg
ctggcggcggtgttgccggtgctgtcgtcgtggcgtcgccgtggacgtgagcgtgccacg
gtggacgggtggcgctaccgcgtgtcgtggtcgccgatgtccgacggggcgggcacggtg
accggtccgtggctggtcgcggtccccgcggggatgaccgccgacccgtgggtgtcggcg
tgtgcggacgccctcgccgggcgtggtgcacggccggtgatggtagagctggggcccgat
gacgccgaccgtgagttggtggcggcgcggctccgcgcggctctggacggggccgaagcg
gccgccgccgcaggggtgttgtccctgctggcgctggccgggggacgccacggccggcat
cggtcggtgcccctgggcgtggccttgacgctgtctctggtgcaggcggtgggcgacgtg
ggcgtagccgctccggtgtggtgtgcgacgcgcggtgcggtcgccgtcgctggttccgag
ggcgtacgtacggtggagcaggcggcggtgtggggcctgggccgcgtggccggtctggag
gtgcccgagcgctggggcggcctgctggatcttcccgaggcgtgggacgcgcgggtggcg
gatcgcctcgcggatgtggtgagcggtcgtacgggcgagagcgaggtcgccgtgcgcggc
tcgggattgttcgcgcgccgtatcgtccgggcgtcgggcggcgggcatggtgtcgggggg
tgggtgccgtcggggacggtgttggtgacgggtggtacgggtgcgttgggtgcccgtgtg
gcgcggtggctggcgtgtgcgggtgcggagcatctgctgttggtgtcgcgtcgtggttct
gaggccgcgggcgtggatgagttgtgtgccgagctcagggagattggtgctggggtgacg
gttgtggcgtgtgatgtgggtgatcgggatgcgttggctggggtgttggcgggggtgccg
gaggagttgccgttgacgggggtggtgcatgcggcgggtgtgttggatgacggggtgttg
gacgggttgtcggtggagcggttcgagggtgtgttgcgggcgaagtcggaggcggcgtgg
catttgcatgagttgacgcgggggctggatctttcggcgtttgtgctgttctcgtcgttt
tcggggatggtgggtgccgctgggcaggcgaactatgcagcggcgaacgcgacgttggac
gcgttggcggagtggcggcggggtgcggggcttccggccacctcggtggcctggggtccc
tgggccgacaacggcatggccgtcagcagcgccgaggtcagccgcaccatccggcgcaat
ggcatgaccgcgatggatccacggctggctctggcggcgctggagcgcgccgtcacccac
ccggacgccgctctcgccgtcgtcgacgccgactgggagcgtttcgccgacaccttcgag
gcccggcggctgtcccggctgctcagcggagtcccggaagtccggaagctgaccgcgacc
gcccggcccggcgacaccgaccccgcgcacaccgaggagtcctcggcactcgtccgccgt
ctggagaccctgtccgaggccgaacggcagcgcgccctgctggagctcgtgcgtgcccac
gtggccgccgtactcgggcacagcggtgtggacgccatcggccccggccgcgccttcatg
gagatcggcttcgactccctgaccgcggtgggcctgcgcaaccagctcagcgaggccacg
ggcgttcagctcccagccaccctggtcttcgactaccccaccccgaacgcgctggccgga
tatctgctcaccgaactgctcggcggccacgcgcggccggacggcgcgccgacggacgcc
gccacgaccgcgtccgccgcggcggacgagccgatcgcgatcgtctcgatgagctgccgc
ttccccggcgacgtacgctccgccgacgatctgtggcggctgctggccgccggagaggat
gccgtctcggccttccccacggaccgtggctgggacctcgacgggctgtacgacacggat
ccggacgcgatcggaaagagctacgtgcgcgagggcgcgttcctctccgaggtgagcggc
ttcgacgcgtccttcttcggcatctcgccacgcgaggcactggcgatggacccccagcag
cggctgctgctggagacgtcatgggagctgtgggagcgggccggaatcgacccggaagcg
gtgcgcggcagccgtaccggcgtgttcatgggcaccaacgggcaggagtacgtgtccctg
gtcgaccgggccccggagaccaccgaaggctatgtggccaccggcaacgcggccagcgtc
gtctccggccgcatctcgtacaccttcggcttcgagggcccggcggtcacggtggacacg
gcctgctcgtcgtccctggtggcgctgcacctggcggcgcaggcgctgcgccagggcgag
tgctccctcgcgctcgccggtggcgtctcggtgatggtgtcaccgcgtggcttcgtggag
ttcagccgtcagcggggtctcgcgcccgacggccggtgcaagccgttcgcggcggccgcc
gacggcacggcctggggcgagggcgtgggcatgctgctgctggagcggctgtcggacgcg
cgccgcaacggccatcagatcctcgcggtggtacgtggctccgccgtcaaccaggacggt
gccagcaacggcctcaccgcgcccaacggcccgtcccagcagcgggtgatccgccaggcc
ctggccaacgccgggctcccggccgggcaggtcgacgtcgtcgaggcgcacggtacgggt
acgacactgggcgatccgatcgaggcgcaggcgctgctggccacgtacggccgggagcac
accgatgaccagcccctgtggctcggctcgatcaagtccaacatcgggcatacgcaggcg
gccgccggtgtggcgggcctgatcaaggtggtgctggccatgcggcacggtctgctgccc
gggatgccgaacgtggacgagccctccccgtatgtggactggtcgcccggcaccgtccag
ctgctgaccgatgccacgccgtggcccgagaccggtcgcccccggcgggcgggcgtgtcc
tccttcggcgtcagcggcaccaacgcgcacgtcatcctcgaacaggcgccttcgccgcga
ccggagctcgagcgggccgccgtgggcatgcccgccggtgacctggggcggctgcccgtc
actccctggccggtctcgggcaagtccgaggccgcgctgcgcacacaggcggaccggctg
ctggcgcatgtgcgcgagcgggcggagctctcggccgatgacatcggcctgtcgctggcg
accacgcgcagtgcgttcgagcaccgtgcggtggtcctggccggggaccgggccggtctg
gtcgatggcgtggcggcactcgcggaggaccgggacgcctcggggctgatccggggtgtg
gccggtgctgacggtcgtgcggtgttggtcttccctggtcaggggtcgcagtgggtgggg
atggcggcggggttgctggagtcttcgccggtgttcgcggggcggatcggggagtgtgcg
gcggcgttggcgccgttcgtggagtggtcgctcggggatgtgttgcggggtggtgagggt
gctgcggtggcgttggagcgggtggatgtggtgcaggcggtgttgtgggcggtgatggtg
tcgttggctgagctgtggcgttcgtacggtgtggagcctgcggcggtcatcggtcattcg
cagggtgagatcgcggcggcgtgtgtggcgggtgcgttgtcgttggaggacgcggcgcgg
gtggtggcgttgcggagtaaggcgttgcgggcgttgtcggggttgggtggcatggtgtcg
gtgtcgttgccggtggactcggtgcgggagcggttgggccggtggggtgagcggttgtcg
gtggcggcggtgaacgggccgtcggcggtcgtggtctccggtgacgcggacgcgttggac
gagctgctggcggcgtgcgaggcggacgaggtccgggcgcgtcgcgttccggtggattac
gcctcgcactgcgcccatgtggaggacatcgagggcgagttgctgcgggagctcgcgggg
atcgctcctcggccgtcgtcggtgccgttctactcgacggtgaccggtggagcgctcgat
acggccgacctggacgccgcgtactggtaccgcaatctgcgccacaccgtgcgcttcgag
gagaccgtacgcgccctgctggccgatggcttcgatacgttcatcgaggccagcgcccat
ccagtgctcaccatgggcgtggagcagaccgccgaggaccatggagcacgggtcaccgcg
gtcggttcgctgcgccgcgacgaaggcgggctcgaccggttcctcacctcactggccgag
gcgtacgtgggcggcgcgtccgtcgactgggcagggctcttcgcgggcacgggcgcgcgg
cgtgtcgatctgccgacgtacgccttccagcaccagcgcttctgggtcgagccgtcagcc
gtggcgggcgatgtgtcgtcggccgggctggtctccaccgaccatccactgctcggcgcg
gcggtcgcgctgcccgagttcggcgggcagctgttcaccggtcggctctcgctccgtacg
cacccgtggctggccgaccacaccattcgcggcaccgcgctgctccccggatccgccctg
gtcgagttggtgctgcgagccggtgacgcggtcggctgcggccatgtggaggagctgacg
caggaaacgcccctcgcccttcccgagagtggcgccgtccagctgcaactgacggtgggc
ggcccggacgactccggacgccgcaccgtgaacctctactcgcgcttcgaggacgggccc
cccgacctgtcgtggacccaccatgccaccggtgtgctggccacggaggggcccacggcg
ccgacggagaccgggctcggccagtggccgccggcggatgcctcgccgatggacctcggc
gaccggtacccgagcgcggccgcgctcggcggtgtcgagtacggtccggcgttccgtgcc
ctgcgccatgcgtggcgtcgcggtgcggagatcttcgccgaggtggcgttggcggaggac
atgcgcccggaggccggtcgcttcggtctgcaccccgtgctgctcgacgcggccctgcac
gccgcggccgagctgacggccgacgacggcggccgcgtccggctcccgtaccggtggacc
ggtatgtccctgtacgccaccggtgcgacgaccctgcgcgtacggctctccacggaacgg
ccggacggcatggcgatcctgctggccgacgaatcgggccacgcggtggccgatgtcgac
gcggtggcgacccgcaccttcacatcggagcagctcaccgggggtcggaggccccatgag
tcgctgttccgggtggagtggatgagtgtcccggcggcctccgccggtgtcgagccggac
cgtgcccactggtcgatcgtcggccctgacggcgccggactgcgcaccgcgctcggaacg
agcggtggccggatcgacgagtacgacgacatgggcgcactgctccggcccgacgcatcg
gccgcggccgtgcccgacctcgtactcctgccgttcctcaccgactcggcaaccgacccc
gtcgcggcggaggacgacctggtgtccgcgacccgtcaggcgacgcatcgcgccctggac
gtgctccaggcgtggctggcagaggagcggtgcgccgactcgcgactggtggtggtgacg
cggggtgccgtggcggccgtggcgggtgaggacgtgccggacacggcggctgccgcggtc
tgggggttggtgcgctcggcacaggccgagcatccggaccgattcgtcctggtggatctg
gagagcctggagtgggccgctgaggcgatcggcgcggcggtggccaccggagagccgcag
atcgccgtgcgtgggggcggcgcgtacgcccccaggctgacccgggctctggtacccgtg
gcgcctcagcgagagccggtgtgggagcccgatggttcggtgctgatcaccggcgccagt
ggtgtgctgggcggtttggtggcacgccatgtggccgcccgccacggggtgcgcagcgtg
gtgctggtgtcgcgtcgcggccgcgacgcggcgggcgcggcggagctggaagccgagctc
gccgacatcggcgcacgcgtggtgttcgaggcgtgcgacgtcgccgaccgggaggcgttg
gccggggtgctggcgcgtattccggcggatcgtccgctgcgcggtgtggtgcatgcggcc
ggtgtgctggacgacggtctggtcgagtcgttgacgccggagcgcatcgacgcggtgctg
cggccgaaggccgacgcggcggtgcatctggatgagttgacgcgggatctggagctgtcg
gcgtttgtgatgttctcctcggccgctgcgacattcggtgcggcgggtcaggggaactac
gcggcggcgaacatgttcctggatgcgctggcggcgcggcgtcgggcgcgtgggcttgcg
ggggtgtcgttggcctggggtttctgggccgaacgcagcgatatgaccggccacttgggc
gaggtcgacatggcccggatggcacggttcgggatgacccccctgaccgccgacgaggga
ctcgcgctcttcgacgcggcacacacgaccgatgacaccctgctggtgccgacgcgtatg
gacgtggcggtgctccgcgcacacgcccggcccggaaccacacccgccctgctgcgccac
ctcatcggagccccggcccgacgggtgatcgacgccgccaccgacgatctgggcggcgcc
accgccctcgtacgccgtctcatggatctgccccggtccgggcgggaggaggtcctgctg
gagctggtgaccgatcacgcgggagccgtcctcggccacacggagtcggacgcgatcgct
cccgaccgcgccttcagcgacatcggcttcgactcgctcaccgcggtcgaactgcgcaac
cgcctcaacgccgccaccggtctgcggcttccggccacgctggtcttcgactatccgaca
ccgaccgcggtcgcccgccacatcctcggcgaggtgatgggctccgcgcgggccgaagcc
gaaaccccggccctcgaccggacccgggccacgccgtcagcgcgccacgccgtgaccgac
gacgagccgatcgccatcgtcggaatgggctgccgcttcccgggcggtgtccgtacgccc
gaagagctgtggcaactgctcatcagcggcggggacgcgatcgcggggctgcccgacgat
cgcggctgggacctggagggtctgtatcacccggatcccgatcaccggggcacggcgtat
gcgcgtgagggtggtttcctgtacgacgcgggtgatttcgatccggcgttcttcgggatt
tcgccgcgtgaggcgctggcgatggatccgcagcagcggttgctgctggagacgtcgtgg
gaggcgctggagcgggccggtatcgacccggcgtcggtgcgcggcagccagaccggcgtg
ttctgcgggctgacctaccacgactacaccgacgcggtgcagcaggccggcgaggccacc
gagggctacctcatgacgggcaacgcggggagcgtcgcctccgggcgcatctcctacacc
ttcggcttcgagggacccgcggtgacggtggacaccgcctgctcgtcgtccctggtggcg
ctgcactgggccgcccaggcgctgcggcagggcgagtgctcgctggccctcgcgggcggc
gccacggtcatggccagcccgctcgctttcgtcgagttcagccgtcagcgcggactggcc
ccggacgggcgctgcaagcccttcgcgggagccgccgacggcaccggatgggccgagggc
gtcgggatgctgctgctggaacggctgtccgacgcgcggcggaacggtcaccaggtgctc
gcggtggtgcgtggcagcgccatcaaccaggacggtgcgtcgaacggtctgaccgcgccg
aatggtccgtcgcagcagcgggtgatccgggcggcgttggagagtgctcggttgtcggct
gctgaggtggacgcggtcgaggcgcatggtacgggtaccaggcttggtgacccgattgag
gcgcaggcgttgctggcgacgtacgggcaggagcgggcggccgaggggtggccgctgtgg
ctgggtgcgatcaagtcgaacattggccatgcgcaggcggctgcgggtgtggcgggtgtg
atgaagatggtgctggcgatgcggcacggtgtgctgccgcagacgctgcacgtggatgag
gcgtcgccgcatgtggactggtcggcgggtgcggtggagctgctgacgcatgcggtggag
tggccggagaccggccgtccccggcgtgcgggtgtgtcgtcgttcggcatcagtggcacc
aacgcacacgtcatcctggaacacgcccccgaggaactgcccgtcgtcgggccggtgacg
gacggatccgccgggtcgacgctggtgccgtgggtggtgtcggcgaagtccgagggtgcg
ctgcgggcccaggcggagcggctgctgtcgtacgcgcgcggtcaggccggggcggagacg
tcggtggccgatgtggcgtcgtcactggtcacgacgcgtagcgcgtttgagcaccgtgcc
gtggtgctggccgctgaccgggctggtcttgtcgatgggctgaaggcactgtcgagtggt
gacctggcgccgggcgtggttcagggttctgcggtgccgggcaagttggcggtgttgttc
tcggggcagggcagtcagcgggtcgggatgggtgaggggttgtatgaggcgttcccggtg
ttcgcggaggcgttcgatgaggtgtgtgcgtggttcgatggggtgttggagtnnnnnnnn
nnnnnnnnnnnnnnnnngggctcagggcgtcaagaccaagcggctgcgggtctcgcatgc
cttccattcacccctgatggagccgatgctggcggagttccggcgggtggccgaggggtt
gtcgtacgcgcctccgcgcatccccgtcgtatcgaacgtgacgggcctcgtcgcggacgc
cgatgcgctgtgctcggccgagtactgggtgcgccacgttcgcgagaccgtgcgcttcgc
ggacggtgtagggagcctggccgacgcgggagtcgccacctacctggagctcggcccgga
cgaggttctgtccacgatgggtga

DBGET integrated database retrieval system