KEGG   Streptomyces rapamycinicus: M271_47200Help
Entry
M271_47200        CDS       T02907                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
src  Streptomyces rapamycinicus
Pathway
src00052  Galactose metabolism
src00511  Other glycan degradation
src00600  Sphingolipid metabolism
src01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    M271_47200
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    M271_47200
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    M271_47200
Enzymes [BR:src01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     M271_47200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 F5_F8_type_C BetaGal_dom4_5 Cellulase
Motif
Other DBs
NCBI-ProteinID: AGP60803
UniProt: A0A0A0NVM8
LinkDB All DBs
Position
complement(11805720..11808788)
Genome map
AA seq 1022 aa AA seqDB search
MAGALVTAAPAQSATVSRAMGGRTVPLTDGWRFALVNPGGITDPTGAYEDAHDPAYDDSA
WREVAVPHDWSIELTPTTDHGTSGGTGFLPGGLGWYRTTFTLPRALEGKRISVEFDGVYM
DSSVYCNGRLVGEHPYGYTGFALDLSEVAHTDGATPNVLAVKVRNRLPSSRWYSGSGIYR
HARLVVSDPVHVARWGTYLTTPGLATTLRAGHATVRARTLVVNESDGRKPVTVVSTVKDP
DGHLVVQAHSALTVGAGDTRTATQELRIDRPLLWSFDTPWRYVLETELRVGQDTTDRYRT
PFGIRHATFDAERGFSLNGQYAKLQGVDLHHDLGALGAAVSADAVLRQLTIMKSMGVNAL
RTSHNPPAPELIEVCERLGIVMLVEAFDCWRTGKNTYDYGRFFDEHCEADITEMVRATRN
SPAVVMWSIGNEIPDSTSTPGLGMAQRLIDAVRAADDTRPVVIGSDKYRALPAEGSPADL
MLAKLDGLGLNYNTAASVDALHARYPRLFLFESESSSETSTRGAYQEPEHLNTGENHTPG
RRQTSAYDNNLASWTMSGEYGLKKDRDRRFFAGQFLWSGIDYIGEPTPYDVFPVKASFFG
AVDTAGFPKDMYHLFRSQWTSEPMVHLVPMDWTGHRPGETVEVWAYSNVATVELFLNGRS
LGVREFDTKKTTDGRAYLETTEPTGDDKTVTSGPYPGSYTSPGGSAGKLHLIWKVPFAPG
ELKAVARRGGRVVATDVLRTAGRPHAVRLTPDRKTVEADGRSLCFVTAEVVDADGVVVPD
ADHLIAFKVTGGSLAGVDNGRQESTERYQASTRTAFHGKALAIVRAGTEAGPLTITARSA
GLRTATATVRATGGTSEPVTRPTPFAPGPGPGAPHHPLADASYSGAPTTLPAAMLDGDPA
TGWSNAFRKPATALLPAFDGARKADWVSVTWSGRRRLRRVEVSFTVDATHTLPASIEVSA
WNGHAYVPVRGASITWATASGTPTVITFDPVRTARLRLDLTSRHPGAADGAQRIVALEAG
DG
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atggccggggcactcgtcacggccgctcccgcccagtccgccaccgtgtcccgcgccatg
gggggacggaccgtcccgctcacggacggctggcggttcgccctcgtcaaccccggcggt
atcacggacccgaccggcgcgtacgaggacgcccacgacccggcgtacgacgactcggcc
tggcgcgaggtcgcggttccgcacgactggagcatcgagctcacccccaccaccgaccat
ggcaccagcggcggcaccggcttcctgcccggcggcctcggctggtaccgcaccaccttc
accctgccgcgcgccctcgagggcaagcggatctccgtcgaattcgacggcgtgtacatg
gactcgtccgtgtactgcaacggacggctcgtcggagagcacccctacggatacaccggt
ttcgccctcgacctcagcgaggtggcccacaccgacggcgccacgcccaacgtcctcgcc
gtcaaggtgcgcaaccggctccccagcagccgctggtactcgggcagcggcatctaccgc
cacgcccggctcgtggtctccgacccggtccatgtggcccggtggggcacgtacctcacc
acccccggcctggcaaccaccctgcgcgccggacacgccaccgtgcgggcgcggacgctc
gtggtcaacgagtcggacggccggaagccggtgaccgtggtctccacggtcaaggacccc
gacgggcatctggtggtccaggcgcactccgccctcaccgtcggggcgggtgacacccgt
accgccacccaggagctgcggatcgaccggccgctgctgtggtcgttcgacactccgtgg
cgctatgtcctggagaccgaactgcgggtgggccaggacaccaccgaccggtaccgcacc
cccttcgggatccgccatgccaccttcgacgccgagcgcggattctcgctgaacggccaa
tacgccaagctccagggcgtcgatctccaccatgacctgggcgcgctcggcgccgccgtc
agcgccgacgccgtgctgcgccagctgaccatcatgaagagcatgggcgtcaacgcgctg
cgcacctcgcacaatccgcccgcgccggagttgatcgaggtctgcgagcggctcggcatc
gtgatgctggtggaggcgttcgactgctggcgcaccggcaagaacacctatgactacggg
cgcttcttcgacgagcactgcgaagcggacatcaccgagatggtgcgcgccacccgcaac
tcccccgccgtggtcatgtggtccatcggcaatgagatccccgactccaccagcaccccg
gggctggggatggcccagcggctcatcgacgccgtgcgcgcggccgatgacaccaggccc
gtggtgatcggctcggacaagtaccgcgcgctgcccgccgagggctcccccgccgatctg
atgctggccaagctcgacgggctgggcctgaactacaacaccgccgcctcggtggacgcc
ctgcacgcccgctatccgcggctgttcctcttcgagtccgaatcctcctcggaaacctcc
acccgcggcgcctatcaggagcccgagcacctcaacacgggcgagaaccacacccccggc
aggcgccagacctccgcttacgacaacaacctcgcgtcctggacgatgagcggcgagtac
gggctgaagaaggaccgggaccggaggttcttcgccgggcagttcctgtggtcgggcatc
gactacatcggcgagcccaccccgtacgacgtgttcccggtgaaggcgtcgttcttcggc
gcggtggacaccgcgggcttccccaaggacatgtaccacctcttcaggagccagtggacc
agcgaaccgatggtccatctggtccccatggactggaccggccaccggccgggcgagacc
gtggaggtgtgggcctactccaacgtcgccaccgtggagctgttcctcaacggccgatcg
ctgggcgtccgtgagttcgacaccaagaagaccaccgatggccgcgcctatctggagacc
accgagccgaccggcgacgacaagaccgtcacctccggcccctaccccggcagctacacc
agcccgggcggcagcgccggaaagctccacctcatctggaaggtgccgttcgcaccgggc
gagttgaaggccgtggcccggcgcggtggccgggtggtggccaccgatgtgctgcgcacg
gcgggacgcccgcacgccgtacggctcacccccgaccggaagaccgtcgaggccgacggc
cgctcgctgtgcttcgtgaccgccgaagtcgtcgacgccgacggtgtggtggtgccggac
gccgatcatctgatcgccttcaaggtcaccggaggctccctggccggggtcgacaacggc
cgccaggagagcaccgagcgctaccaggcgagcacccgcaccgccttccacggcaaggcc
ctggccatcgtccgcgccgggaccgaggccgggccgctcaccatcaccgcccgctcggcg
gggctgcgcaccgccaccgccaccgtccgcgccaccggcgggacctcggagccggtcacc
cgccccacgccgttcgcgcccggccccggccccggcgccccgcaccacccactggccgac
gcgagctattcgggcgcgccgacgaccctgcccgcggcgatgctggacggcgatccggcc
accggctggtcgaacgccttccgcaagcccgcgacggcgctgctccccgccttcgacggc
gcccggaaggccgactgggtctcggtgacctggagcgggaggcggcggctgcgccgtgtc
gaggtgtcgttcaccgtggacgccacgcacaccctgcccgcctcgatcgaggtgtccgcg
tggaacggccacgcgtacgtcccggtgcgcggggcgtccatcacctgggccaccgcctcc
ggcaccccgaccgtcatcaccttcgacccggtgcgcaccgcacggctgcggctggacctc
accagccgtcatccgggcgcggcggacggcgcccagcgcatcgtcgccctcgaggccggt
gacggctga

DBGET integrated database retrieval system