KEGG   Spirosoma radiotolerans: SD10_00170Help
Entry
SD10_00170        CDS       T03819                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
srd  Spirosoma radiotolerans
Pathway
srd00020  Citrate cycle (TCA cycle)
srd00310  Lysine degradation
srd00380  Tryptophan metabolism
srd01100  Metabolic pathways
srd01110  Biosynthesis of secondary metabolites
srd01120  Microbial metabolism in diverse environments
srd01130  Biosynthesis of antibiotics
srd01200  Carbon metabolism
Module
srd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
srd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:srd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SD10_00170
  09105 Amino acid metabolism
   00310 Lysine degradation
    SD10_00170
   00380 Tryptophan metabolism
    SD10_00170
Enzymes [BR:srd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SD10_00170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AKD53551
UniProt: A0A0E3V5D1
LinkDB All DBs
Position
complement(35342..38137)
Genome map
AA seq 931 aa AA seqDB search
MDQYSYIANSDAAYVDQLYQSYKQDPQTVDESWQQFFKGFEFSLTYGEKANGTHNGESAE
AKSNGVSSNGSANGQTTATKPVDASHAEKEVSVASLIKAYRSRGHLLAKTNPLKERKNRQ
PRVDLPDYALSEADLDTVFESGKLLGIGPATLRVIMESLRKIYAGDIGFEYMYIRELDVK
NWLRNKIEKEALVFMPTSDEKKRILEKLNEATVFENFLATKYLGQKRFSLEGGEVTIPAL
DTIISQAADMGVEEVMIGMAHRGRLNVLANILGKSYESIFDGFEGNVPEQVHGDGDVKYH
LGYSSLTETKSGKQISVKLAPNPSHLEAVNPVVEGFVRAQADEEYKGDFTKIMPILIHGD
AAVAGQGIVYEVTQMAKLAGYTTGGTVHFVINNQIGFTTDFEDARSSIYCSDVAKIIDAP
IFHVNGDDPEAVIFCAKLAVEFREKFNRDVFIDMVCYRRYGHNEADEPKFTQPTMYNIIE
KHQNPREIYKELLIKRGDVDAELATRMDTEFKKQLQDRLDRVKQKAEIPYKPLRLDRDWA
ELRFSEPKDFEKSPETGVPAEVLQTIGKALVKTPEGFKPLKQIDKLLKDRQTMLTDTKLV
NWGTAELLAYGSLLLDGKPVRLSGQDVQRGTFSHRHAVLHDAETNLSYSSLDFIEDGQQK
FQIYNSLLSEYGVLGFEYGYAMANPQALVIWEAQFGDFSNGAQLIIDQFIAAGESKWGIQ
NGVTMLLPHGYEGQGPEHSNARPERYLQLYADYNMVVANVTTPANLFHIMRRQLAWNFRK
PLVIMSPKSLLRHPKCISPLEDLTKGSFQEIIDDSYAQAKKVKRVLLCTGKIYYDLLEKQ
QADQRDDVAIVRLEQLAPLPKNQLDAVLDQYKKAELIWVQEEPENMGYWSYLLRIGLTLP
IISRKAAASPATGYPKIHTQEQADIVRRAFE
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggaccagtactcatatatcgctaattccgacgcggcttacgtagatcaactttatcag
tcttacaaacaagacccacagacagttgacgaaagctggcaacaattttttaaagggttt
gagttttcactcacctatggcgaaaaagccaatggaacccacaacggtgaatcggctgaa
gcaaagtcgaacggtgtctcatcgaatggttcagcaaacggccagacgacagcaaccaaa
ccggtcgatgccagccatgctgaaaaagaagtgtcggttgccagcttaatcaaggcatac
cggtcacgcggccatttactggcgaagaccaatccgctcaaagagcgcaaaaatcgccaa
cctcgtgtcgatttgccggattatgcgctgtcagaagcggatctggataccgttttcgaa
tcaggcaaactgcttggtatcggccccgccacgctccgtgtcatcatggagtcgctgcgt
aaaatttacgcgggcgatatcgggttcgagtacatgtacatccgtgagctggatgtgaag
aactggctccggaataagatcgaaaaggaagcgctcgttttcatgcctacctcggatgag
aaaaagcgtattctcgaaaagctcaacgaagcgaccgtcttcgaaaacttcctggcgact
aaatacctcggccagaaacgtttctcgcttgaaggtggcgaagtgacaattcccgcgctg
gatacgatcatcagtcaggcggccgatatgggcgttgaagaagtgatgattgggatggcg
caccgcgggcggcttaacgtactggccaacattctgggcaaatcctacgagtcgatcttc
gacggtttcgaggggaatgtgcccgaacaggtacatggcgatggggacgtgaaatatcac
ctcggttattcaagtttgaccgagacaaaatccggaaagcagatcagtgtaaaactggct
cctaacccatcccacctggaagcggtcaatcccgttgtggaaggctttgttcgggcgcag
gccgatgaagaatacaaaggcgatttcacgaaaataatgcctatcctgattcacggtgat
gccgccgtggccggacagggtattgtgtatgaagtaacgcaaatggccaaactagctggt
tatacaaccggtggtacggtccattttgtcattaataaccagatcggtttcacaaccgat
tttgaagatgcccgctcgtctatttattgttcagatgtagcgaaaatcatcgacgcccct
attttccacgtaaacggcgacgatccggaagccgttattttctgtgcgaaactagccgtt
gagttccgtgaaaaattcaaccgggatgtgtttatcgacatggtttgctaccgtcgctac
ggccacaacgaggccgatgagccgaaatttacgcagccaacgatgtacaacatcatcgaa
aagcaccagaatccacgcgagatttacaaagaactgctcatcaagcggggcgacgtagat
gccgaactggccacgcgcatggatactgaattcaaaaagcaattacaggatcgactcgac
cgcgttaagcaaaaagcggaaattccgtacaagccgcttcggctggaccgggactgggcc
gagcttcggtttagtgagccgaaggatttcgaaaaatcgcccgaaacgggcgtgcctgcc
gaagtcctgcaaaccattggtaaagcgcttgtcaaaacgcctgaaggcttcaagccgcta
aaacagattgacaagctgctgaaagaccgtcagaccatgctcaccgacaccaaactggtg
aactggggtacggcggaactgctggcctacgggtcgttgctgctcgacggtaagcctgtt
cgtttgagtggtcaggatgttcagcggggtacattctcgcaccgccatgcggtattgcac
gatgccgaaacgaacctatcgtattcgtcgctcgactttattgaggatggccagcagaaa
ttccagatttataactccctgttgtcagaatacggtgtgttagggtttgaatatggctat
gccatggctaatccacaagcgctggttatctgggaagcccagtttggcgacttctccaac
ggtgctcagttgatcatcgatcagtttattgcggctggagagtcgaagtggggcatccag
aacggtgtaacgatgcttcttccccacggctacgaaggccaggggccagagcactccaac
gcccgccctgaacggtatttgcagttatacgcggactataacatggtggtggccaacgta
actacgcccgctaacctgttccacattatgcgtcgtcagttggcctggaacttccgtaag
ccactggtcattatgtcgccgaagtcgttgttgcgccatccgaaatgcatttctccgctg
gaggatctcacaaagggttcattccaggaaatcatcgacgacagctatgcgcaagcaaaa
aaggtaaaacgggtgttgctctgtacgggtaagatctattatgatctgctcgaaaaacaa
caggccgatcagcgtgacgatgtggctattgtacgactggagcagctcgctccactgccc
aaaaaccagttagatgccgtactggaccagtacaagaaagcggagttgatctgggtacag
gaagaacctgaaaacatgggctattggtcttacctattgcgcattggtttgactttgccc
attatttcgcggaaagctgcggcttcaccagctacgggctatccaaaaatacatactcag
gaacaagccgatatcgttcggagagcgtttgaataa

DBGET integrated database retrieval system