KEGG   Spirosoma radiotolerans: SD10_12685Help
Entry
SD10_12685        CDS       T03819                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
srd  Spirosoma radiotolerans
Pathway
srd00473  D-Alanine metabolism
srd01100  Metabolic pathways
srd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:srd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SD10_12685
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SD10_12685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:srd01011]
    SD10_12685
Enzymes [BR:srd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SD10_12685
Peptidoglycan biosynthesis and degradation proteins [BR:srd01011]
 Precursor biosynthesis
  Racemase
   SD10_12685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AKD55626
UniProt: A0A0E3V7P8
LinkDB All DBs
Position
complement(3125000..3127543)
Genome map
AA seq 847 aa AA seqDB search
MLTKEFQLINRQWFTDSRQVTGPVTDARSAEAVFFAIQGEHHDGHAFIGDLYRKGIRQFV
VERSALTPERQHELATYPDAQFMEVESSLHMLQTLAAEHRRQFRIPIIGITGSNGKTIVK
EWLAQLLEGSSSSDGFVVAKSPKSYNSQLGVPLSVHTLTESDTLGIFEAGISKAQEMQAL
EAVIRPTIGIFTNIGTAHDEGFRTRKQKIAEKLRLFIHANTLIYSVDYTDIDEEVNMLLK
AINPDMRLITWSLTGQPATYQGSLQGNRLSLQEKQRDNRLVLSLPFTDPASLENLMHCIV
TMLALRAWDTAELQSRLNRLRPVSMRLEQKEGINNCVLIDDSYNNDVVGLQLALRFLNQQ
RTRSRRVVILSDVLQSGQPEADLYQQVGEIIRAHDVEQFIGVGPVVSQNAHFFAANSQFY
ATTDEFLTRFLFSDLRDSTVLVKGARPFSFERIVHRLERKVHGTVLEINLDALTHNLNYY
RERIARSEDAASRPSDTKLMVMVKAFAYGSGSAEVAQLLQYHRVDYLAVAYADEGVSLRQ
NGVDLPIMVMNPAPETFATLLEYKLEPELYSLRMLREWGSYIREQSRSVAGESAAGATGY
PVHLKIDTGMHRLGFVESEIPTVADYLIHNPALRVATVFSHLVGADDAQFNTFTETQYAC
FIRNTTVLESALGYRPTRHLLNSAGIVRFPEYKLDMVRLGIGLYGVEAAQIDQAALQPVG
TLRTVISQIKTVQAGESVGYSRRGVLDHDARIATLAIGYADGYDRRLGNGIGEVWVNGTR
CPTVGNVCMDMTMIDVTAASASEGDEVIIFGPELPITGLAQRIGTIPYEILTGVSERVKR
VFFKEGN
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgcttacaaaagagttccaattgattaaccgacagtggtttaccgactcacgacaggtg
acgggtcctgtcacggatgcgcggtcggctgaggctgttttttttgctatacagggcgaa
caccacgacgggcatgcattcatcggcgacttgtaccggaaaggtatacgccagtttgtc
gtcgaacggtcggccttgacaccagagcgccagcatgaactggccacttatcccgacgcc
cagtttatggaagtggaaagtagcctgcacatgctgcaaaccttggccgctgaacaccgc
cgacagtttcggattccgattattgggatcacgggcagcaatggtaaaaccatcgtgaag
gaatggctggctcaattgctcgagggaagttcctcgtcggacgggtttgtcgtagccaaa
agccctaaaagttataactcgcagttaggagtcccgttgtccgtgcacaccctgaccgag
agcgacactctagggatctttgaggccggtatttccaaagcccaggagatgcaggccctc
gaagccgtaatccggcctacgattggcatttttacgaacattggtacggcgcatgatgag
ggatttcgaacccggaaacaaaaaatagcagagaaacttcggctgtttatccatgccaac
accctgatttactccgtcgattacactgatattgacgaagaagtcaatatgttgctgaaa
gccattaatccggatatgcgactcataacctggtcgttaacgggtcaaccggctacgtat
caaggttcattgcagggaaaccggctaagcctgcaggaaaaacaacgggacaacaggtta
gtgctgtctctcccgttcaccgacccagcctcgctggaaaacctgatgcactgcattgta
acgatgctggcactccgcgcctgggatacggctgaactgcaaagtcgactgaaccggttg
cggccggtttccatgcggctggagcagaaagaaggcattaacaattgtgtgctcatcgac
gattcgtataacaacgatgtagttggtttacagctcgctctgcgtttcctgaaccagcaa
cgtacccggagtagacgggtcgttattttgtcggatgtgcttcagtccgggcaacccgaa
gcagacctgtatcagcaggtcggggagataattcgtgcccatgatgtggagcagttcatt
ggcgttgggcctgtcgttagccagaacgcccatttttttgcggctaacagccagttttat
gcaacgaccgatgaatttctgacccgcttcctattcagcgatctgcgcgatagtacggtt
ctggtaaagggagcccggcccttttccttcgaacggattgtgcatcggctggagcgtaaa
gttcatggcacagtgctggaaataaacctggatgctttaacccataacttaaactattac
cgtgaacggattgcccggagcgaggatgcggcatcccggccatcggataccaaactgatg
gtcatggtgaaggcatttgcctacggaagtgggagtgccgaggtagctcaattgctccag
tatcatcgggtcgactacctggcggttgcatatgctgacgagggcgtatcgctccggcag
aatggcgtcgacctgcccataatggtgatgaatcccgcccccgaaacctttgctactctc
ctggaatacaagcttgaacctgaattgtatagcctgcggatgctgcgggaatggggaagc
tatattcgggaacaatcgagatcagtagcgggtgaatcggctgcaggagctaccggctac
ccagttcatttgaaaattgatacgggcatgcaccggcttgggtttgtcgaaagtgaaatt
ccgaccgttgccgattacctgattcataacccggctttacgggtcgcgacggtattcagc
catttagttggggccgatgatgcgcagtttaacacctttaccgaaacccaatacgcgtgt
ttcatccgaaacacgacggttctcgaatcagcccttggctatcggccaacccggcattta
cttaattcggccggtattgtccgtttccccgagtacaaactcgatatggttcggttaggg
attgggctgtatggagtggaggctgcccagatcgatcaggccgctttgcaaccggtaggt
acgttacgcaccgtaatcagccagatcaaaaccgttcaggcaggggagtcggtgggttac
agtcgccggggcgtacttgaccacgacgcccggattgctacgctcgccattgggtatgcc
gacggctacgaccgccggttgggaaatggcattggcgaggtgtgggtaaatggaacccgc
tgtccaaccgttgggaacgtctgcatggacatgaccatgatcgacgtgacagctgcatcg
gccagcgaaggggatgaggtaatcattttcggccctgaacttccaatcacggggcttgct
caacgcatcgggactattccctacgagattctaaccggtgtcagcgaacgcgtcaaacgg
gtgttttttaaggaaggaaactaa

DBGET integrated database retrieval system