KEGG   Spirosoma radiotolerans: SD10_17820Help
Entry
SD10_17820        CDS       T03819                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
srd  Spirosoma radiotolerans
Pathway
srd00473  D-Alanine metabolism
srd00550  Peptidoglycan biosynthesis
srd01100  Metabolic pathways
srd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:srd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SD10_17820
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SD10_17820
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SD10_17820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:srd01011]
    SD10_17820
Enzymes [BR:srd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SD10_17820
Peptidoglycan biosynthesis and degradation proteins [BR:srd01011]
 Precursor biosynthesis
  Amino acid ligase
   SD10_17820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AKD58608
UniProt: A0A0E4A1X5
LinkDB All DBs
Position
4374573..4376225
Genome map
AA seq 550 aa AA seqDB search
MKIGIFFGGPAREREVSFAGGRTALANLDKGLFEPVLVFVDGRGRFRLVSPEFLQSPSLR
DALPQDNSGFSVYDESLAPDALDATLPELRPEQFRNHFDMAFLAMHGPDCEDGAIQGLLE
WYKVPYTGPGLLGSAVGINKILQNELIALANGQQKKTATISRDAYEQADKAQFFQSLVDH
LGLPIVVKAPHQGSSIGVAIVREADLALFCRSVEQCFFTMSVQPDGWSRLSEWSALSTDE
KKELAQKMVSLDSGISFPVVIEQTGDVIKHPADFVTKLDAIARQGQPVSLASLNAEDEVL
FEEFITGQEFSCGVIQDDDQIAIALPPTEIYNVTSFDFESKYKLNTTKKRIPVETSLENN
RKIQLAVAEVFSRLGINVYSRIDGFLTPAGDVLLHDPNTIPGMSPSSLIFKQMAEIGLNL
SNSLTYLIRQSLRERIRTGKDTFHLKHLLALLDAQLAARKANPLPERVVSFGPTDEEFIA
AKQQYNDLAASGTVLPSLMYIKSKQESHEIPVNLLFKDTIAELETALSQPRHPLLIETAE
RARHITERYV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataggcattttcttcggtggaccagcgcgggagcgggaggtctcgtttgccggt
gggcgtactgccctggctaatttagataaagggttgttcgagccggttctggtgtttgtg
gatggacgcggacggtttcggcttgtatctcctgaatttctgcaatcaccatcgctgcgc
gatgccttaccacaggataactctggcttttcagtatacgatgagtcactggcgcctgat
gcacttgatgctacattacccgaattacgcccggaacagtttcgaaaccatttcgacatg
gcctttctggctatgcacggccccgactgcgaagacggtgccattcagggcctcttagaa
tggtacaaggtgccttacacagggccagggctgcttgggtcggcagtgggtattaacaag
atcctgcaaaacgagctgattgcactggcgaatggccaacagaaaaaaacggctaccatt
agccgggatgcctacgaacaggctgataaagcccagttttttcaatctctagtcgatcac
ctgggcctgccgattgttgtcaaagctcctcatcagggttcatccattggtgtcgctatc
gttcgtgaagcggacctggctttgttttgccgttctgtggagcaatgtttcttcaccatg
agcgtacaaccagatggctggagcaggctaagtgagtggtcagccctgtcaactgatgaa
aaaaaagaactggctcagaaaatggtcagtttagactcaggcattagttttccagttgtc
attgagcaaacaggcgacgtaatcaaacacccggccgatttcgttacgaagctggacgca
attgcccggcagggccagccagtgtcgctagcttcgttgaacgccgaagacgaagtgctg
ttcgaagaatttattactggtcaggagttttcctgtggcgttattcaggacgacgaccag
attgccattgctttgcctcctacggagatctataatgtaacaagcttcgatttcgaatcg
aagtataagctgaatacaaccaaaaagcggatacccgtagagacaagtctggaaaacaat
cgtaagattcagttggcggtagcggaggtattcagccggttgggtatcaacgtctattca
cggattgatgggttcctgactcctgctggagatgtgctcctgcatgatccaaacactatt
ccaggcatgtcaccctcctcgctgatcttcaaacagatggctgaaattgggttgaactta
tcgaattcgcttacgtacctcattcgccagtcgctacgggaacgcattcggacggggaaa
gacacgttccatttgaaacacctgctggcattgctggatgcacaacttgccgcccgtaaa
gccaatccgttgcccgagcgggtcgtttcatttggccctactgatgaagaattcattgcc
gcgaaacagcagtataatgacctggccgcttccggtacagtgctgccctcgttaatgtac
atcaagagcaaacaggaatcgcatgagattccggtcaacttgctttttaaagatacaatt
gctgagttggagacagccttaagtcagccgcgtcaccccttattgattgagacagccgaa
cgtgcccgacatattaccgaacgatacgtatag

DBGET integrated database retrieval system