KEGG   Spirosoma radiotolerans: SD10_21750Help
Entry
SD10_21750        CDS       T03819                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
srd  Spirosoma radiotolerans
Pathway
srd00500  Starch and sucrose metabolism
srd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SD10_21750
Enzymes [BR:srd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SD10_21750
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     SD10_21750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AKD58712
UniProt: A0A0E4A1Q6
LinkDB All DBs
Position
5353504..5355132
Genome map
AA seq 542 aa AA seqDB search
MEELWYKNGLVYSVDVEVFKDSNNDGVGDFDGLTQQLDYLKTIGVETIWLAPFQPSPNED
DGYDISDFYGIDKRLGTSQDFDECIRQANQKGIRIMMDLVTNHTSDQHPWFQQARRSKDS
PYRSWYVWAKERPKKWDSGMVFPGVQKDIWTYDKQAGEYYYHRFYEAQPDLNMQNPAVQR
EMRKIIRYWLDKGIAGFRVDAVPFLIEVANADFDPDKPEHQFDMITQLHQYSQWHKRDAI
LLGEANVDPKEQEPYFGNEGQGMQTMFNFFVNQHLFYALATGETASLKEALNATKNIPPT
AQWANFLRNHDEIDLGRLSDTERSKVYARFGPDTTMQLYDRGIRRRLAPMLGDPRLINLA
YSVLFSLPGMPVIRYGEEIGMGDDLSLKERLSVRTPMQWSAEPNAGFSTSAKPVRPIISQ
GPYSYKTVNVAAQRADSSSLLNRISHFARLRKQCPEIGWANGKILDTNSDHVVAIQYDWQ
GRSLVTVYNFSSEPQQCQVKSSIKTGLTLVNLFDQTNNTIGGSGAVSIKLAGYGSAWYRL
KN
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
attgaggaattgtggtataaaaacggcctcgtgtatagtgtcgatgtcgaggtctttaaa
gactccaacaacgatggcgtcggtgattttgacgggctgacccagcaactggattacctc
aaaacaataggcgtcgaaaccatctggctggctcccttccagcccagccccaacgaagac
gatggctatgatatatcggacttttatggcatagataagcgcctgggtacgagccaggat
tttgacgaatgcatccgtcaggccaatcaaaagggaattcgaatcatgatggatttagtt
acgaaccacacgtccgatcagcatccctggtttcagcaggctcgtcggagcaaagattcg
ccctaccggtcctggtatgtatgggccaaagagcgcccgaaaaaatgggatagtggcatg
gtgtttccgggagttcaaaaagatatctggacgtacgataaacaggcaggcgagtactat
taccaccgcttctatgaggcccagccagacctgaatatgcagaatccggcggtgcagcga
gaaatgcggaaaattatccggtactggctcgacaaaggcatagctggttttcgggtcgat
gcggttccgtttctgatcgaggtagccaatgcagacttcgaccctgacaaacccgaacat
cagttcgacatgatcacccaactgcatcagtacagccagtggcataaacgggatgctatc
ctgttgggcgaagccaatgtagaccccaaagaacaggagccttattttgggaatgaaggg
cagggcatgcaaacgatgtttaacttcttcgtcaatcagcatttattctatgcgctggct
accggcgaaacagcctcgctaaaagaggctctgaacgcaacgaagaacattccccccaca
gcccagtgggccaactttctccgcaaccacgatgaaattgacttaggtcggttaagcgat
accgaacggagtaaagtgtatgcccggtttggccccgacaccaccatgcaactctatgac
cggggcattcgtcggcgcttggcacccatgctgggcgacccacgcctgatcaatttggcc
tatagtgtactcttctcgttgcctggtatgcccgttattcgatacggcgaagagattggt
atgggcgatgaccttagcctgaaagagcggctgtcggttcgaacgccgatgcaatggtca
gcggagcctaatgctggtttttcgacatcggccaaacccgttcggcccatcattagccag
ggaccttacagctataaaaccgttaatgtagcggctcaacgcgcggactcgtcctcgctc
ctaaaccggattagccactttgcccgccttcggaaacagtgccccgaaattggctgggca
aatgggaaaattctcgacaccaactccgatcatgtggttgccattcaatacgactggcag
ggacgctccttagtgacagtctataattttagttcggagcctcagcaatgccaggtgaaa
agctccatcaaaacgggtcttacactggtcaatttattcgaccagacaaacaataccatt
ggtggcagtggggcggtttcgattaagctggcaggctatggttcagcctggtatcggttg
aaaaattaa

DBGET integrated database retrieval system