KEGG   Spirosoma radiotolerans: SD10_24340Help
Entry
SD10_24340        CDS       T03819                                 

Definition
(GenBank) zinc-dependent alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
srd  Spirosoma radiotolerans
Pathway
srd00040  Pentose and glucuronate interconversions
srd00051  Fructose and mannose metabolism
srd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SD10_24340
   00051 Fructose and mannose metabolism
    SD10_24340
Enzymes [BR:srd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SD10_24340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C TrkA_N Pyr_redox_2 ADH_zinc_N_2 ThiF UDPG_MGDP_dh_N ApbA Shikimate_DH Methyltransf_15 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AKD57559
UniProt: A0A0E3ZZB5
LinkDB All DBs
Position
complement(5993363..5994409)
Genome map
AA seq 348 aa AA seqDB search
MKALVLTQYNQLDLQDVPKPTIRPNEVLVRVKAVGICGSDVHGMDGSSGRRIPPIVMGHE
ASGIIAEVGSDVRNWATGDRVTFDSTVYALDDWYSRRGQYNLSDGREVVGVSTPDFKRNG
AFAEYVSVPQHILYAVPDNVSFTQAALVEPVAVALHAVSLTPIQINDSAVVVGAGMIGLF
VIQALKLAGCDTIIAIDLDEDRLALAQKLGATHTINAGVTDPQHGDVLTQVQNLTHGRGA
DVSFEVVGAGPSVKTAIDCVRKGATVTLVGNLAPTVEIPLQAVVTRQLRLQGSCAINGEY
EAALALISSGRINVGAILSAEVPLEEGADWFKRLYDKEKGLIKVVLKP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactcgttcttactcaatacaatcagctcgatttacaggatgtgcctaaacca
actattcgacccaacgaggtattggtgcgagtaaaggccgtcgggatttgcggctccgat
gtgcatggcatggatggaagtagcggtcgacgcattccgcccatcgtcatgggccatgaa
gccagcggaatcatcgccgaagtgggcagtgacgtgcgcaactgggccactggagaccgc
gttaccttcgactcaacagtatatgccctcgatgactggtatagccgacggggacagtat
aacctcagcgatggccgcgaagtcgtgggtgtatcaacgccggacttcaagcgcaatggt
gcctttgccgaatatgtctcggtgccacaacatatcttatacgctgttcccgacaatgtc
agctttacccaggctgctttagttgagccggtggcggtcgccctacatgcagttagtttg
acgcctattcaaatcaacgattccgcagtggtcgttggggctggcatgattggccttttt
gttattcaggcgctcaaactggcgggttgtgatacgatcatcgccattgatctggatgag
gatcggctcgccctggcgcagaagctgggcgctacacatacgatcaatgccggagtaact
gatcctcagcatggcgatgtgctaacgcaggttcaaaatctcacccacgggcgtggtgct
gatgtttcctttgaagttgtcggagcagggccaagcgtcaaaacagccatcgactgcgtt
cggaaaggcgctaccgtgaccctagtgggtaatctggctccaacggtcgagattccgttg
caggccgttgtgacccggcaattgcggttgcagggctcctgcgccatcaacggcgaatac
gaggccgcgctggccctgatttcatccggtcgtattaatgtcggagccattctgagtgct
gaagtgccactggaagaaggcgctgactggtttaaacgactctacgacaaagaaaaagga
ttaattaaagtagtcctgaaaccgtaa

DBGET integrated database retrieval system