KEGG   Spirosoma radiotolerans: SD10_27865Help
Entry
SD10_27865        CDS       T03819                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
srd  Spirosoma radiotolerans
Pathway
srd00240  Pyrimidine metabolism
srd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SD10_27865
Enzymes [BR:srd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SD10_27865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK Toxin_ToxA
Motif
Other DBs
NCBI-ProteinID: AKD58148
UniProt: A0A0E3ZZV4
LinkDB All DBs
Position
complement(6848629..6849258)
Genome map
AA seq 209 aa AA seqDB search
MFIEPSRRREPPHLRTGWIEVICGSMFSGKTEELIRRLNRARIAKLNVEIFKPALDTRYH
DENIVSHSALAIHSNPVQTAGQIPPLAGNCDVVGIDEAQFFDKDILDVCNLLANQGKRVI
VAGLDMDFSGQPFGCMPQLMSIAEYVTKVHAICVVCGDIAQYSYRLVPSQDRVLLGETDS
YEARCRRCFNLGSDAGRKEWAYETVVNDE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgaaccatcccgacgacgcgaaccgccccatctccgcactggctggatcgaa
gtaatctgtggatcgatgttctccggaaaaacggaagagttaattcgtcgacttaaccga
gcacgtattgccaagctgaacgttgagatctttaagcctgcgctggatacgcgttaccac
gacgaaaacatcgtgtcgcattcagcactggctatccattctaatcctgtgcaaacggcg
ggccaaattcctcccttagccgggaactgtgatgttgttggtatagacgaggcccagttt
tttgataaagacattctggatgtctgtaacttgctggccaaccagggcaagcgcgtaatc
gttgccgggcttgatatggacttttcggggcaaccgtttggctgtatgcctcaactcatg
agcatcgctgaatacgtcacgaaggtccacgctatttgtgtggtctgtggcgacattgcc
cagtattcttatcggctcgttccctcgcaggaccgcgtacttttaggtgaaaccgatagc
tacgaagcccgctgccgacgctgctttaacctcggcagcgacgctggccgcaaagagtgg
gcctatgagactgttgtgaatgatgaatga

DBGET integrated database retrieval system