KEGG   Salpingoeca rosetta: PTSG_00637
Entry
PTSG_00637        CDS       T04136                                 

Definition
(RefSeq) hypothetical protein
  KO
K09850  Ras association domain-containing protein 1
Organism
sre  Salpingoeca rosetta
SSDB
Motif
Pfam: RA C1_1 Nore1-SARAH
Other DBs
NCBI-GeneID: 16078702
NCBI-ProteinID: XP_004998106
UniProt: F2TX21
LinkDB
Position
Unknown
AA seq 385 aa
MSNPGRYWRRRKADRDEDRSSSGEPSGKTSPSTSPQTLRAKLKTPVDRKRPNSPRSSPLL
RRLSTFIKQKSSSKSKLSSKAKKKLIKHEFDHLELTQPTWCDLCDDIIWGLLRPCVQCKR
CMYTCHLDCADQVELACVQRTVQGPREPHVHPRQTQEGIDAGAQGLLAYLTAEDVAAKVD
KYNCNRTNNFIEMLDNEPGSKNFKGYIRVTLNLTRPIRVSSDESIVNNSPEQSECLAVPV
SPAIAGSSHRFFRSSGSASSSGSHEGETFFLPKHVSKGLYVTSATTAQEVIAILLRKFRV
TSNPRKFALFERNTASGSERRLRRFEEPLALQLLWGEKSEHFELSLKEYNQEYEFHWEEF
SLAELENFCTILDREEQAACEQPLQ
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgagcaatcccggacgatactggcggaggagaaaggctgatcgagatgaagatcgctcc
tcgagcggcgagccatctggcaagacatcaccaagcacatccccacagacgctgcgagca
aagttgaagactcccgtagacaggaagcgcccaaacagtccgcgatccagtccccttctc
cgccggctcagcaccttcatcaaacagaagagctccagcaaatccaaactgtctagcaaa
gcgaagaaaaagctcatcaagcacgagtttgaccatcttgagctgacgcagccgacgtgg
tgcgacttgtgcgacgacatcatctggggacttttgcggccttgcgtccagtgcaaacgg
tgcatgtatacgtgtcatcttgattgtgcggaccaagtggagctggcgtgtgtgcagcgg
acggtgcaaggaccacgtgagccccacgtgcacccgcgccagacgcaggaaggcatcgat
gccggtgcccagggcttgctcgcgtaccttaccgctgaggatgtggctgcgaaggtggac
aagtacaactgcaaccgcactaacaactttatcgaaatgctggacaacgagcccgggtcc
aagaacttcaaaggttacatccgcgtgacgctgaacttgacccgccccatccgcgtgtca
tctgacgagtccattgtcaacaactccccagaacagagcgaatgcctggctgtgcccgtc
tcaccagcaatcgcaggctcatcgcatcggtttttccgcagctccgggtcggcgtccagc
tctggctcgcacgagggcgagacgttcttcctccccaaacacgtgtcaaaaggcctctac
gtcacctccgcaaccacagcacaggaggtgattgccatcttgctgcgcaagtttcgggtg
acgagcaacccgaggaagtttgccctctttgaacgcaacaccgcatccggaagcgagcgg
aggttacggcgctttgaggagccacttgcgctgcagctgctgtggggcgagaagagcgaa
cactttgagctctccttgaaggagtacaaccaggagtatgagtttcactgggaggagttt
tcgctggcggagctggagaacttctgcaccatcctcgatcgggaagagcaagcggcctgt
gaacagccactgcagtga

DBGET integrated database retrieval system