KEGG   Salpingoeca rosetta: PTSG_04401Help
Entry
PTSG_04401        CDS       T04136                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
sre  Salpingoeca rosetta
Pathway
sre00500  Starch and sucrose metabolism
sre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PTSG_04401
Enzymes [BR:sre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PTSG_04401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 Trefoil PRIMA1
Motif
Other DBs
NCBI-GeneID: 16075075
NCBI-ProteinID: XP_004994493
UniProt: F2U8G2
LinkDB All DBs
Position
Unknown
AA seq 596 aa AA seqDB search
MARAVLLATTVVAVVLGVLTAQCAADTCQVPDPSKKDCGYMGINQQQCEAKGCCWQPDGQ
GSSTPWCFYKGSGPPPPPPPPPPPPPPPGQAPFSKSEVEKMRGYFLKNIDIQGSGGVVAS
PDPNTPGGSYYYHWARDGALTMHAFQITSSSASDYDTQMQHYTKWVVARHAESDPNNIDV
RIEPKFELPSGTPYTGGWCRPQTDAPGLRAITLIAYANDLIQRGQKDFVMQYLWTGDSSS
YYGGAIKHDLDWIANNWEQNSCDLWEEVQSNDFFWNRYTMRKALTNGVAFAQAMGDSQSS
QAYGRVLASLSPTLQRHYNGQFVFEADNRQQDAAVICAFNDGNLNDGVFAPNSAEVAGTI
STLNSLFSSSFPINQKDDAAGVPGILYGRYSGDQYAGGNPWVLTSGCLAEVLYRAANSTA
ATRRMPTAEATEHFKAIAAQLNPAAVAAENLDMDTPAGLARALVLSGDGVLNRIRAHTIN
NDLHQPEQLDKNTGAEASATDLTWSYATILKAMAVRDTITSAASTLTSGFVNARLVVGTA
DLAAARDAAPAATQRGLPSWVAPVGAVGAACAIVAAVGVVITYRRNRQRAAYAPIA
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgctgtgctgctggcgaccactgttgttgctgttgttctcggggtgttgacg
gcccagtgtgccgctgacacctgccaggtccccgatccaagcaagaaggactgtgggtac
atgggcatcaaccagcaacaatgcgaggccaagggctgctgctggcagccagatggacaa
ggttcatccaccccatggtgcttctacaagggctcgggcccaccaccgccaccacctccg
ccaccacctccaccaccaccaccaggccaggccccgttctccaagtccgaggttgagaag
atgcgcggctacttcctgaagaacatcgacatccaaggctccggcggtgtcgtcgccagc
ccagaccccaacacgccaggcggcagctactactatcactgggcccgcgatggtgcgctc
accatgcatgccttccagatcacatcctcttctgccagcgactacgacacgcagatgcag
cattacacgaaatgggttgttgctcgccacgctgagtctgaccccaacaacatcgacgtg
cgcatcgagcccaagtttgagctgccatctggcacaccatacaccggcggctggtgccgt
ccgcagacggatgcccctgggctccgcgccatcaccctcatcgcatatgccaacgacctg
atccagcgtggccagaaggactttgtgatgcagtacctgtggaccggcgactcatcctcg
tactacggcggcgccatcaagcacgaccttgactggatcgccaacaattgggagcagaac
tcctgcgacctgtgggaggaagtccagtccaacgacttcttctggaaccgctacaccatg
cgcaaggccctcacaaacggcgttgcctttgcccaggccatgggcgactcgcagtccagc
caggcgtacggccgcgtgctcgccagcctgagccccaccctccagcgccactacaacggg
cagtttgtgtttgaggcggacaacaggcagcaggatgctgcggtcatctgcgcattcaac
gatggcaacctgaacgatggcgtgttcgcccccaacagtgccgaggttgcaggcaccatc
tccaccctcaactcgctcttctcctcgtcgttccccatcaaccagaaggacgacgctgcc
ggcgttcccggcatcctctacggccgttacagcggcgatcagtacgcaggcggcaaccca
tgggtcctgacgagcgggtgtctggctgaggtcctctatcgcgctgccaacagcaccgcc
gccacgcgccgcatgccgactgcagaagccacggagcacttcaaggccattgccgcacag
ctcaacccagctgctgtcgctgcagagaacctggacatggacacgccagccgggctcgcc
cgcgccctcgtgctgagcggtgacggtgtgctgaaccgcatccgtgcacacaccatcaac
aacgacctgcaccagcccgagcagctcgacaagaacacgggcgccgaggccagcgccaca
gacctcacgtggtcgtatgcaaccatcctcaaggccatggctgtccgtgacaccatcacc
tccgctgcgtccacgcttacgtctggctttgtcaacgcacgcctcgttgttggcacggct
gaccttgctgctgcacgcgacgcggcacctgccgccacccaacgcggcctgccttcgtgg
gttgcccctgtcggtgccgttggtgctgcgtgcgccattgttgccgccgtgggtgtcgtc
atcacgtacaggcgcaaccgccagcgtgctgcctacgcccccattgcctga

DBGET integrated database retrieval system