KEGG   Salpingoeca rosetta: PTSG_05663Help
Entry
PTSG_05663        CDS       T04136                                 

Definition
(RefSeq) xylitol dehydrogenase
Organism
sre  Salpingoeca rosetta
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 16074109
NCBI-ProteinID: XP_004993532
UniProt: F2UBV3
LinkDB All DBs
Position
Unknown
AA seq 399 aa AA seqDB search
MALLRSAAAAAGAVAAAAACVRPVTVAARRTAMTRALVLNKVDDLELREIDVDEPFTDDD
VRIDIHKVGICGSDIHYYEHGSIPPFYVNEPMILGHEASGIVTEVGKNVTHLKVGDRVCM
EPGVPDFRSDITLAGKYNLDPNVRFWATPPADYATQINGAGSPWKAGHGCLRPSVVHPGA
FTFKLPDNVPLEVGALVEPLSVGMHAATKAQIRPGATAAVLGAGPIGMVTVLSALAAGCS
RVLVSDLSPAKLSIAESLAPGKVKAFPAAGGSEIDEMKAHLGGKGADVVFECAGHHDVAA
NAVKLAGIGGRVILIGCAAQPVPLDVGLMLTKELTMMGIFRYAGVYPAAINLLSSGAIDL
TPIISKHWTFDQSVEAFDFARNAPPDVVKNVIHVRNDAE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcttcgatctgctgcggccgcagctggtgctgtggctgctgctgctgcttgt
gttcgccctgtcactgtggcggcaaggcggacggcgatgacccgtgcgcttgtgctgaac
aaggtggatgacctcgagctccgcgagattgatgtggacgagcccttcaccgacgatgat
gtccgcatcgacattcacaaagtcggcatctgcggctccgacatccactactacgagcat
ggaagcatcccaccattctatgtgaacgagcccatgatcctcggccacgaggcatctggc
atcgtcacggaggttggcaagaacgtcacacaccttaaggttggagatcgcgtgtgcatg
gagccgggtgtgcctgatttccgcagcgatatcacgcttgctggcaagtacaacctggat
cccaacgtccgcttctgggccaccccacccgcagactacgccacccaaatcaacggagca
gggtcaccgtggaaggctgggcacggctgcctccgcccgtccgtggtgcatcctggcgca
ttcacgttcaagctccccgacaatgtcccgctggaggttggtgcgttggtggagcccctc
tccgtcggcatgcacgccgctaccaaggcccagatccgcccaggcgcaacggctgctgtg
ctcggtgcgggccccattggaatggtgacggtcctgtctgcgctcgctgcgggctgctcg
cgtgttcttgtctccgacctctcccctgcaaagctgagcattgcggagtcgctcgcccca
ggcaaggtgaaggcatttcctgctgctggcggcagcgagattgatgagatgaaggcgcat
cttggtgggaagggcgccgatgtcgtctttgaatgcgccggtcaccacgacgtcgcagca
aacgccgtcaagcttgctggtattgggggtcgtgtgatcctgattggatgcgcagcgcaa
cccgtcccgctcgacgtcggcctcatgctcacgaaagagctgacgatgatgggcatcttc
cggtatgcgggggtgtacccggcagccatcaatctcctgagttccggcgcaatcgacctc
acgccaatcatctcaaagcactggacgtttgatcagtctgttgaggcgtttgactttgcg
cgcaacgctcccccagatgtcgtcaagaacgtcatccacgtccgcaacgacgccgagtaa

DBGET integrated database retrieval system