KEGG   Salpingoeca rosetta: PTSG_05872Help
Entry
PTSG_05872        CDS       T04136                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sre  Salpingoeca rosetta
Pathway
sre00020  Citrate cycle (TCA cycle)
sre00190  Oxidative phosphorylation
sre01100  Metabolic pathways
sre01110  Biosynthesis of secondary metabolites
sre01130  Biosynthesis of antibiotics
sre01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PTSG_05872
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PTSG_05872
Enzymes [BR:sre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PTSG_05872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 16073336
NCBI-ProteinID: XP_004992765
UniProt: F2UD13
LinkDB All DBs
Position
Unknown
AA seq 645 aa AA seqDB search
MNATASRARSCLTAVRRLHAGRTAKAAEQVSSAYPIIDHEFDAVVVGAGGAGLRAAFGLT
QHGFKTACITKLFPTRSHTVAAQGGINAALGNMEEDDWRFHFYDTVKGSDWLGDQDAIHY
MTREAPKTVIELENYGMPFSRTEEGRIYQRAFGGQSLKFGKGGQAHRCCAVADRTGHSLL
HTLYGQSLRYDTAYFIEYFALDLIMNDEGACVGVLAMCQEDGTLHRFHCKNTVLATGGYG
RAYFSATSAHACTGDGNAMVARAGLQNEDLEFVQFHPTGIYGAGCLITEGCRGEGGILLN
SEGERFMERYAPTAKDLASRDVVSRSSTIEIREGRGCGPNKDHVYLQLSHLPTEVLQERL
PGIVETAAIFAGVDATKEPIPVLPTVHYNMGGVPTNYRGQVIKNVNGQDEVVPGLYAAGE
VACASVHGANRLGANSLLDIVVFGRACANTIAEEDKPGAKIPDMPANAGEASIANLDQVR
HANGSATTAELRLEMQKTMQSHAAVFRTGEVLQEGCDLLAKTYDTMVSDLKTFDRGMVFN
TDLIEALELQNLMTCALQTIVSAEARKESRGAHSREDYKDRVDEYDYTKPIEGQTKLSFD
EHWRKHTLSTFDTAKGSVDLKYRPVIDDTLDKQECETVPPVIRVY
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaacagcgtctcgtgcccgctcctgcctcacggccgtgcgccgccttcacgcg
ggccgcacagccaaggccgccgagcaggtgtcgtctgcttaccccatcatcgaccacgag
tttgatgccgtcgtcgttggtgccggtggtgccggccttcgcgccgccttcggcctcacc
cagcacggcttcaagactgcttgcatcaccaagctcttccccacccgctcccacaccgtc
gctgctcagggtggtatcaacgccgccctcggcaacatggaggaggacgactggcgcttc
cacttttacgacaccgtcaagggttcggattggcttggcgaccaggacgccatccactac
atgacccgcgaagcccccaagaccgtcatcgagcttgagaactacggcatgcccttctcc
cgaacggaggaaggccgcatctaccagcgcgcctttggtggccaaagcctcaagtttggc
aagggcggccaggcccaccgctgctgcgccgtcgctgaccgcacgggccactccctcctc
cacaccctctacggccagtccctccgctacgacacggcctacttcattgagtactttgcg
cttgacctgatcatgaacgacgagggcgcctgcgtcggtgtcctggccatgtgccaggag
gacggtaccctgcaccgcttccactgcaagaacaccgtgcttgccactggtggttacggc
cgcgcctacttctccgccacctctgcccacgcctgcactggtgacggcaacgccatggtt
gcccgcgccggcctccagaacgaggacctcgagtttgttcagttccacccaacgggcatc
tacggtgccggctgcctgatcacggagggttgccgtggtgagggcggtattctgctcaac
agcgagggcgagcgcttcatggagcgctatgccccgacggccaaggaccttgcctcccgc
gacgtcgtctcccgctcctccaccattgagattcgcgagggccgcggctgcggacccaac
aaggaccacgtgtacctgcagctgtcgcacctgccaacggaggtgctgcaggagcgcctg
cccggtattgttgagacggccgccatcttcgccggtgttgacgccaccaaggagcccatc
cccgtgctgcccaccgtccactacaacatgggcggcgtgcccaccaactaccgcggtcag
gtcatcaagaacgtcaacggccaggacgaggtcgtgcccggcctgtacgctgctggcgag
gttgcctgcgcctctgtccacggtgccaaccgcctcggcgccaactccctcctcgacatt
gttgtcttcggccgcgcgtgcgccaacacgattgcggaggaggacaagcccggcgccaag
atccccgacatgcccgccaacgccggcgaggcctcgattgccaacctggaccaggtgcgc
cacgccaacggcagcgccaccaccgccgagctgcgtctggagatgcagaagaccatgcag
agccacgccgccgtcttccgcacgggcgaggtcctgcaggagggctgcgacctccttgca
aagacctacgacaccatggtgtctgacctgaagacgtttgaccgcggtatggtgttcaac
acggatctgattgaggcccttgagctgcagaacctgatgacgtgcgccctgcagacgatt
gtctctgccgaggcccgcaaggagtctcgcggcgcccactcgcgcgaggactacaaggac
cgcgtggatgagtatgactacaccaagcccatcgagggccagaccaagctctcctttgac
gagcactggaggaagcacaccctctccacttttgacacggcgaagggctctgttgacctg
aagtaccgccctgtcatcgatgacacccttgacaagcaggagtgcgagaccgtgccccct
gtcattcgcgtctactaa

DBGET integrated database retrieval system