KEGG   Salpingoeca rosetta: PTSG_06384Help
Entry
PTSG_06384        CDS       T04136                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sre  Salpingoeca rosetta
Pathway
sre00250  Alanine, aspartate and glutamate metabolism
sre00410  beta-Alanine metabolism
sre00430  Taurine and hypotaurine metabolism
sre00650  Butanoate metabolism
sre01100  Metabolic pathways
sre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PTSG_06384
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PTSG_06384
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PTSG_06384
   00430 Taurine and hypotaurine metabolism
    PTSG_06384
Enzymes [BR:sre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PTSG_06384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-GeneID: 16073848
NCBI-ProteinID: XP_004993273
UniProt: F2UCR6
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MSNRNMEGKRQAVLDQADELEQLLAKVTPRVVEYIRQNADVDGSKVVEYVPPEELKSKMG
IELPEEGTGTDEIVERIDRVLKYSVRTGHPRFLDKLYAGSDPVGQVSEFLTAVVNTNVYT
YAVAPVFTLMELEVLRKVAAVVGFDDATMEGMLVPGGSFANFVAMVAARHHAFPHVRMDG
WKPDDKPIAFCPEQAHYSLKRAAMMVGIGMNGIVGVKCDRKGRMIVSELDAALEKAVAEG
KKPFFVSTSAGSTVMGGFDPFVEIRQVCDKYNVWMHVDAAWGIASKFTPRMEQTTAGLEL
ADSCTWDGHKSLGMPIFAAAVMTQKHQGLFHAANSSSADYLFHSHEQVSYDLGDMTLQCG
RRADSIKMWFAWLRHGTQGFRDRIEKALDIVDYMVARIKADPRFKLVEDPMYTNVCFWYL
PPSLRDTEDLTSVYPKLGTVTSTLCRRMQEAGTMLVNINPLGDHGLPHFFRLIINNTTVT
TGDMDFVLEEMDRLGSSL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgcaacatggagggcaagcgacaagccgttcttgaccaggccgatgagctg
gagcagctcctggcaaaggtcacgccacgcgtcgtggagtacatccgccagaacgcagac
gtcgacggctcgaaggtggtggagtatgtcccaccagaggagctgaagtccaagatgggc
attgagctgccggaggaaggcacgggcacggacgagattgtggagcggattgaccgcgtt
ctcaagtacagcgtgcgcacaggccacccccgcttcctcgacaagctctacgcaggcagc
gaccctgtgggccaggtgtcggagttcctcactgcagttgtcaacaccaacgtgtacacg
tatgcggttgcgcccgtcttcaccctcatggagcttgaagtgcttcggaaggttgccgct
gtcgtcggctttgacgacgcaacaatggaaggcatgcttgttcccggcggctcgtttgct
aactttgttgccatggtcgcggcccgccatcacgccttcccgcacgtccgcatggacgga
tggaagcccgatgacaaacccattgcgttttgcccagagcaagcccactactccctcaag
cgcgcagcaatgatggttggcatcgggatgaacggcattgtgggcgtcaagtgcgatcgc
aaagggcgcatgattgtgagcgagcttgatgcagcacttgagaaggccgtggcggagggc
aagaagccgttcttcgtcagcaccagcgctggctcaaccgtcatgggtgggtttgaccct
tttgttgagatccggcaggtgtgcgacaagtacaacgtgtggatgcacgttgacgctgcg
tggggcattgcgagcaagttcacaccacgcatggagcagacaacagctgggctcgagctc
gcagactcctgcacatgggacggccacaagagtcttggcatgccgatctttgcagccgct
gtgatgacgcagaagcaccagggccttttccacgccgcaaacagctcctccgcagactac
ctcttccactcgcacgaacaagtgtcgtatgacctcggggacatgacactgcagtgcggg
cgccgcgcagacagcatcaagatgtggtttgcctggctccgacacggcactcagggtttc
cgtgaccgcattgagaaggcgcttgacattgttgactacatggttgcgcgcatcaaggct
gaccctcgcttcaagcttgttgaggatcccatgtacaccaacgtgtgcttctggtacctg
ccgccttccctccgcgacacagaggacttgacgtccgtgtaccccaagctcggaaccgtc
accagcacgctttgcaggcggatgcaggaggcgggcacgatgctggtgaacatcaatcct
ctcggcgatcacggtcttccgcacttcttccgcctcatcatcaacaacaccaccgtgacg
acgggcgatatggactttgttctcgaagagatggatcgcctcggcagcagtctttag

DBGET integrated database retrieval system