KEGG   Salpingoeca rosetta: PTSG_10090Help
Entry
PTSG_10090        CDS       T04136                                 

Definition
(RefSeq) CAMK/CAMK2 protein kinase
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
sre  Salpingoeca rosetta
Brite
KEGG Orthology (KO) [BR:sre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sre01001]
    PTSG_10090
Enzymes [BR:sre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     PTSG_10090
Protein kinases [BR:sre01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   PTSG_10090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr CaMKII_AD SnoaL_3 DUF4440 Kinase-like Kdo SnoaL_2 APH Act-Frag_cataly F420_oxidored
Motif
Other DBs
NCBI-GeneID: 16069543
NCBI-ProteinID: XP_004989001
UniProt: F2UPG5
LinkDB All DBs
Structure
PDB: 

Position
Unknown
AA seq 479 aa AA seqDB search
METETSFFDLYDVDLKDKRSVIGKGAFSTVHRCVNKRTGEVCAVKVIALKSLRSSEINKI
KREIGICSSLQHEHIVSMRRAFRDESHFYLVFEYVSGGELFDEIVTRKFYNEKDASACMH
QILSALQHCHSKNIIHRDLKPENLLLASKDPNAPVKITDFGLAVIMEQGPTYFGFAGTPG
YLSPEVIRRVPYDTAVDVWACGVILYILLVGYPPFWEEDHQKLYAQIKNCQYDFPSPEWD
SVTTAAKELIKAMLEPNPKRRPTVQELLQHPWIARRDVPGSVHRQATLEELKKFNARRKL
KGGVNAVIGVSKMMRTMQEATRALTLSAKSKQAATVAEKQDTLVPAGPAKAVLEVNDELL
KAVASGDWDAYTTMVDPNVTCFEPEAAGVLAKGLAFHKFFFDNRSPNADKMKTTLHDPAV
QMFGDTAIVTALRVVQFVADDGPKTTRYEETRVWVKDAAFKFGWKLVHFHRSGAHATPN
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgaaaccagcttcttcgacctctacgacgtcgacctcaaggacaagcgctcc
gtgattggaaagggagcgttcagcacggtgcaccgctgtgtcaacaagcggactggcgaa
gtgtgcgccgtcaaggtgattgccctcaagagcctcagatcttcagaaatcaacaagatt
aagcgggaaatcggcatctgctccagtttgcaacacgaacacattgtgtctatgcggcgt
gccttccgcgacgagtcgcacttctacctcgtgtttgagtacgtctctggcggcgagctg
tttgacgagattgtcacgcgcaagttctacaatgagaaggacgccagtgcctgcatgcac
cagattctctccgccctccaacactgccactccaagaacatcatccatcgcgacctcaag
ccggaaaacctgttgcttgcaagcaaagatccaaatgcgcccgtcaagatcaccgacttt
ggccttgccgtcatcatggagcaaggcccaacatactttgggtttgccgggacccccggg
tatctgagtcccgaggtgattcgtcgcgttccgtacgacacggcggtggacgtatgggcc
tgtggcgtcatcctgtacattcttctggttggctacccgccgttttgggaggaggaccac
cagaaactctatgcgcagatcaagaactgccagtacgactttccttcgccggagtgggac
tccgtcaccactgcagccaaggaattgatcaaagcgatgcttgagccaaatccaaagcgc
cgcccaacggtgcaagagctgctccagcatccctggatcgcgcggcgcgacgtccccggc
agcgtgcaccgtcaggccacgctggaggagctgaagaagttcaacgcccgccgcaagctc
aagggcggggtcaatgctgtgattggggtgagcaagatgatgcggacaatgcaggaggcg
acgcgtgccctcacgctttccgccaagagcaaacaggctgccaccgtcgccgagaaacag
gacacccttgtcccggcaggcccagcaaaggcggtgctggaggtgaatgacgagctcctc
aaggccgttgcttctggcgactgggacgcatacacgaccatggttgatccaaacgtgaca
tgctttgagcccgaggccgccggcgtcctggcaaagggcctcgctttccacaagttcttc
ttcgataaccgctcgccgaacgcggacaagatgaagacgactctccacgatccggccgta
caaatgtttggcgacaccgccattgtcaccgccctccgcgttgtccagtttgtcgctgac
gatggtccaaagacgacacgatacgaggagacacgcgtatgggtgaaggacgcggcgttc
aagtttggatggaagctcgtgcacttccaccgctccggtgctcacgccacgccaaactga

DBGET integrated database retrieval system