KEGG   Salpingoeca rosetta: PTSG_12888Help
Entry
PTSG_12888        CDS       T04136                                 

Definition
(RefSeq) hypothetical protein
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
sre  Salpingoeca rosetta
Pathway
sre00052  Galactose metabolism
sre00500  Starch and sucrose metabolism
sre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PTSG_12888
   00500 Starch and sucrose metabolism
    PTSG_12888
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sre04147]
    PTSG_12888
Enzymes [BR:sre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PTSG_12888
Exosome [BR:sre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTSG_12888
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 16070271
NCBI-ProteinID: XP_004989720
UniProt: F2UMP8
LinkDB All DBs
Position
Unknown
AA seq 914 aa AA seqDB search
MMTGRLALQGVLRQRLLTLLAMVAVVAGGHAVCADATIVFPTQDGIVVPLDEHNVELAAV
KPGWLRLSVFSSNARDGGRVPTPMVSVGHNDTPAFSWWQDDGYVIFRTADGRLVLAENGT
TWALQGPDNTTIMLSKKLLSKPSPSSSDLLLHVNRSSDAHVYGCGRLTNTTKVLPLNCSR
GLPLVSEFGFLSSFAWSTDGFAMFGVVPDNDARSQPFLNLSWAQATEEFLWQFSAHHPRL
DLYLAPAPTLRDAVVLLWNLTGAPGLLPSYSLSFLASRSGWEEPPSISKAVDEFSSGHFP
LSAVVADYEWFSPESDAQLPPEGAANFSDFGLNPAVLPGGPKFLQQLRSQGVHFGGVRWP
RLGNTALLREAGSLGCLFHEPPRHLRFNDKACREWYTRQLQADTQAGVSFFWNTGGDSAY
YTYMYWARAQTNAFKDHIPPTTTTTTTTTTTTTTSTTTTTTSTTTTSTTTTSTTTTTTST
TTTTTTRRTSTTSTTSTTSTSSSSSSTTVRLHPQFHNKTAQAESPIVQWRALRTRAGEGQ
PEPSSASCNGTHRRPFSLSNAFTPGIQSLGNVATTGRIGSSWDDLEAAAGDIVAYLMAGT
AFVSVDIGGNSQGTVPDTLLVRWYQLGLFTTVPRSSSARTSSPHFPFDAQTPPAVDAIRA
AMRLRQRLMPTIYAAMVWQHVLLEPMLRPLLFEFPNDAEAAQTATQWLLGSGLMVAPVLS
SSDQVQVYLPVGLWFPFTQTPTSSPTQGIAGPTHHDVVAELADIPLMVRAGTLLALQDVG
SSPSPPGLLTIYVYAGRNASIAVVEDDGKHYCGSGRVTTFSWNDDTLVLSWTRTAASSGG
GGGGGGRVGDGDVTGEAEANSVLFPAASPGYIVVQAVLWQNGTAPIQSHARNIGLSGFLD
FATLMSPNSHKRTL
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgatgactggacgacttgcactgcaaggggtgctgcggcagcggctcctgacactgctc
gcgatggtggcggtggtggcgggaggccatgcggtgtgcgcggatgcaacaattgtgttc
ccgacacaggatggcattgttgtgcctctggacgagcacaacgtcgagctggcggcagtg
aagcctggctggctgcgcctgtcagtgttctcctcaaacgcccgcgatggcggccgcgtg
ccaacaccaatggtgagcgtgggccacaacgacacgcccgcgttctcctggtggcaggac
gacggctacgtcatcttcagaacagcggacgggcgcctggtgctggcagagaacggcaca
acgtgggcgctgcaaggccccgacaacaccacgatcatgttgtccaagaagctgttgtcc
aagccgtccccaagcagcagcgatctcctcttgcatgtcaaccgcagcagcgacgcacac
gtgtacggttgcgggcgcctgaccaacaccaccaaagtgctgccgctgaactgctcgcgc
ggcctgccgcttgtgtccgagtttgggttcctctcctcctttgcctggagcaccgacggc
tttgccatgtttggggttgtgccagacaacgacgcgcggtcgcagccattcctcaatctc
tcctgggcacaagccacggaggagtttctctggcagttctcggcgcaccacccgcgcttg
gacttgtacctggcaccagcgcccaccctgcgcgacgcagttgtgctgctctggaacctg
acgggcgcgccggggctgctccccagctactcgctctccttcctcgcttcaaggtctggc
tgggaggagccgccgtccatcagcaaagccgtggacgagttctcctccggccacttcccg
ctctcggcggttgtggcagactacgagtggttctccccagagtccgacgcgcagctgccg
cccgagggcgcagccaacttctccgactttggcctcaacccggccgtgcttcccggcggg
cccaaattcctgcagcagctgcgcagccagggcgtgcacttcggcggcgtgcggtggccg
cgcctggggaacacggcgctgctgcgggaggcgggctccctcggctgcctgtttcacgag
ccaccgcggcacctgcgcttcaatgacaaggcgtgcagggagtggtacacacgccagctg
caggcagacacgcaagccggcgtgtccttcttttggaacacgggaggggactcggcttat
tacacgtacatgtactgggcgcgggctcagaccaacgcgttcaaggatcacatcccaccc
acaacgaccacaacaacaacaacgacaaccaccacaactacgagtacgacaacgaccaca
acgtcaaccacaacaacaagcacaacaacaacatcaactaccactaccacaacgtcaaca
accacaaccacaaccacgagaagaacaagcacaacaagcacaacgagcacaacaagcaca
tcatcatcatcatcatcgaccacggtgcggcttcatccacagtttcacaataagaccgct
caagctgaatcgcccatcgtgcaatggcgggccttgcgcacgcgtgctggagagggtcaa
cccgagccctcttctgcctcgtgcaacggcactcatcggcgacccttcagcctgagcaac
gcgtttacgcccggcattcagtccctgggcaacgtggccaccacgggccgcattggctcg
tcatgggacgacttggaggcagcggcaggagacattgtggcctacctgatggcgggaaca
gcgtttgtctccgtggacattggcggcaactcgcagggcaccgtgcccgatacgctgctg
gtgcgctggtatcagcttgggttgttcacgaccgtgccccggtcaagttcggcacgcacg
tccagcccacatttcccctttgatgcgcaaacgccgccagcggtggacgcgattcgggcg
gcgatgcgcctgcgccagaggctgatgccgaccatctacgccgccatggtgtggcagcac
gtgctgttggagccaatgcttcgcccgctgttgtttgagttccccaacgacgcggaggcg
gcgcagacggccacgcaatggctgcttgggtctgggctgatggtggcgcccgtgctgtcg
tcgtcggaccaagtgcaggtgtacctgcctgtcggcctgtggttcccgttcacgcagaca
ccaacgtcatcgccgacccagggcattgccgggcccacccaccacgacgttgtggcggag
ctggctgacatcccgctgatggtgcgggcgggaacgctgcttgcgctacaggacgttggc
agctcgccgtcgccgcccggcttgctcaccatctacgtgtatgccgggcgaaacgcgtct
attgcagtagtggaggatgatggcaagcactactgcggatctgggcgcgtgacgacattt
tcgtggaatgacgacacgctcgtgttgtcgtggacacgcacagccgcttccagtggtggt
ggtggtggtggtggtggtcgagttggtgatggtgatgttacgggcgaagcggaggcgaat
tcggttttgtttcctgctgcgtcgccagggtacattgtggtgcaggccgtgttatggcag
aatggcactgcacctatccagtcgcatgcgcggaacattggcctgtcggggttccttgat
ttcgcaaccctgatgtcacccaacagccacaaacgcacactgtag

DBGET integrated database retrieval system