KEGG   Stenotrophomonas rhizophila: BAY15_0823Help
Entry
BAY15_0823        CDS       T04500                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
srh  Stenotrophomonas rhizophila
Pathway
srh00620  Pyruvate metabolism
srh00680  Methane metabolism
srh01100  Metabolic pathways
srh01120  Microbial metabolism in diverse environments
srh01200  Carbon metabolism
Module
srh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:srh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAY15_0823
  09102 Energy metabolism
   00680 Methane metabolism
    BAY15_0823
Enzymes [BR:srh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BAY15_0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AOA71257
UniProt: A0A1B2N1M8
LinkDB All DBs
Position
967162..969870
Genome map
AA seq 902 aa AA seqDB search
MNEYRSSIVFATPDIPLRDDVRRLGALVGDLLAEQVSTQFFDDVEQVRTRAIARRESEAP
LSDLNDALTGLPPERAEAMVRAFSTYFQVVNIAERVHRIRRRRDYQRAGTAPQPDGLQDA
LQQLKAQGVTLEELASWLPRIDIEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGQRTP
GEAAADAARFRMALTASWQTTDSSPVRPTVDDEREHVGFYLVQVLYRVIPVLYESLQQAL
LDTYGDSVPLPRLLRFGTWVGGDMDGNPNVDAGTIRNTLDAQRQAVLGRYQKDLLQLASL
LSQSTERVAVSDALEARVAHYQQLLPKVVSRPRHADMPYRLLNDRMRARVQATLEDTEGA
YASPQELEEDITLILDSLHANKGDHAGGFAVRRLLWRVRTFGFHLARLDVRQESSVHGRA
LASVLDGQDAWDAADAIARAQRLSPFASGEQALPASTEEGGQRLDAVFAALADARRRHGA
DALGSYIISMAHDRSDVLAVLALARRGGLVDDAGAVPLDIAPLFETVDDLQRGTDTLRDL
LADPVYRAHLAARDDVQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEVAAESGIRLTFF
HGRGGSISRGGGKTTDAVDASPRGSIDGRLRVTEQGEVIHRKYGIRALALRSLEQSTGAV
LRSSLRPRAPEPREAQWRPVMDLVARKSAEAYRAFVGQPDFMQYFRQATPIDVIERMTLG
SRPSRRLGQDAALTNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAIDAGHADTLQEMARD
WPFFSTFLDDIAMVLSKGDITIAEQFSQLAGPLHDRFFPQIQHELALTGRQILAITGQDE
LLQHDQRLALSIRLRNPYIDPISVLQVDLLRRWRDSGGEDDEVLRALVACVNGVSQGVQN
TG
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagcatcgtctttgccacccccgacattcccctgcgtgacgac
gtgcgccgactcggcgcactggtcggcgacctgcttgccgagcaggtctccacgcagttc
ttcgatgatgtggaacaggtgcgcacccgcgccatcgcgcgccgtgaaagcgaggcgccg
ctgtccgacctcaacgatgcattgaccgggctgccgcccgaacgcgccgaagcgatggtg
cgtgcgttcagcacctacttccaggtggtcaacatcgccgagcgggtgcaccgcatccgc
cgacgccgcgattaccagcgcgccggtaccgcgccgcagcccgatggcctgcaggatgca
ctccagcagctcaaggcgcagggcgtcaccctggaggagctggccagctggctgccgcgc
atcgacatcgagccggtgttcaccgcgcacccgaccgaagcggtgcgccgcgcactgctg
gaaaaagaacagctgatggtggccagcctggtcgacaacctcgacggccagcgcacccca
ggcgaagccgcggccgatgcggcgcgcttccgcatggcactcaccgcgtcctggcagacc
accgattcctcaccggtgcgtcccaccgtggacgacgagcgcgaacacgtcggcttctac
ctggtgcaagtgctgtaccgggtaatcccggtgctgtacgaatcgctgcagcaggcattg
ctcgatacctacggcgacagcgtgccgctgccccggttgctgcgcttcggcacctgggtg
ggcggcgacatggacggcaacccgaacgtggatgccggcaccatccgcaacaccctcgat
gcgcagcgccaggccgtgctgggccgttaccagaaggacctgctgcagctggccagcctg
ctcagccagtccaccgagcgggtggcggtcagtgacgcgctggaggctcgggtggcgcac
taccagcagctgctgccgaaggtggtttcgcgcccgcggcatgccgacatgccctaccgc
ctgctcaacgaccgcatgcgcgcgcgggtgcaggccacgctggaagataccgagggcgct
tacgcctcgccgcaggaactggaggaggacatcaccctcatcctcgacagcctgcatgcc
aacaagggcgaccacgccggtggcttcgcggtgcgccggctgttgtggcgggtacgcacc
ttcggcttccatctcgcgcggctggacgtgcgccaggagtcgagcgtgcatgggcgcgcg
ctggccagcgtactggacggccaggacgcctgggacgcggccgatgcgatcgcgcgcgcg
cagcggttgtcgccgttcgccagcggtgagcaggcactacccgccagcaccgaagagggc
ggtcaacgccttgatgcggtgttcgccgcactggccgatgcccgccgccgccacggcgcc
gatgcgttgggcagctacatcatttccatggcgcatgaccgcagcgatgtactggccgta
ctggcgctggcgcgacgtggcggactggtggacgacgccggtgcggtgccgctggatatc
gcgccgctgttcgaaaccgtggacgacctgcagcgcggcacggatacgcttcgcgacctg
ctggccgatccggtgtaccgcgcgcacctggccgcgcgcgacgatgtgcagatggtgatg
ctgggctattcggacagcggcaaggacggcggcatcgccgcctcgcgctggggcctgcag
cgggcccaggtggagctgctggaggtggccgcggagagcggtatccggctgaccttcttc
catggccgtggcggctcgatcagccgcggcggtggcaagaccaccgatgcggtggatgca
tcaccgcgtggcagcatcgatggccgcctgcgcgtgaccgaacagggcgaagtgatccac
cgcaagtacggcatccgcgcgctggcgctgcgctcgctggaacagtccaccggtgcggtg
ctgcgctccagcctgcgcccgcgtgcacccgaaccgcgcgaggcgcagtggcgcccggtg
atggacctggtcgcgcggaaaagcgcggaggcctatcgggcattcgtcggccagcccgat
ttcatgcagtacttccgccaggccaccccgatcgacgtgatcgagcggatgacgctgggc
tcccggccctcgcggcggctcggccaggacgcggcgctgaccaacctgcgcgcgattccg
tgggtgttcgcctggagccaggcgcgtgcggtgattccgggctggtatggcgtgggcagc
ggactgcaggcggcgatcgatgccgggcatgcggatacgctgcaggagatggcgcgcgac
tggccgttcttcagcaccttcctggacgatatcgcgatggtgctgtccaagggcgacatc
accatcgccgagcagttctcgcagctggccggaccgctgcacgaccggttcttcccgcag
atccagcacgaactggcgctcaccggcaggcagatcctggccatcaccgggcaggacgaa
ctgctgcagcacgaccagcgcctggcgctgtcgatccgcctgcgcaatccctacatcgac
ccgatcagcgtgctgcaggtggacctgctgcggcgctggcgcgacagcggcggcgaggat
gacgaagtgctgcgcgcgctggtggcgtgcgtcaacggcgtctcccagggcgtccagaac
accgggtaa

DBGET integrated database retrieval system