KEGG   Stenotrophomonas rhizophila: BAY15_0873Help
Entry
BAY15_0873        CDS       T04500                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
srh  Stenotrophomonas rhizophila
Brite
KEGG Orthology (KO) [BR:srh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BAY15_0873
Enzymes [BR:srh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BAY15_0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO AlaDh_PNT_C FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 Glutaredoxin K_oxygenase Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: AOA71307
UniProt: A0A1B2N1S7
LinkDB All DBs
Position
complement(1017928..1019520)
Genome map
AA seq 530 aa AA seqDB search
MLDANLQSQLKTYLERVTRPIQITAHADDGAKSQEMLELLETLVSLSSQITLDVRRDGAE
RTPSFALTTPGQDIHLAFAGLPMGHEFTSLVLALLQVGGHPSKATAEVIEQVQGLEGEYR
FETYFSLSCQNCPDVVQALNLAAVLNPRIQHVAIDGGLFPAEVEARQIMSVPTVYLNGEV
FDQGRMSLEQIVAKLDTGSAKRDAAKIAAKAPYDVLVIGGGPAGAAAAIYAARKGIRTGV
AAERFGGQVLDTMAIENFISVKETEGPKLAMALEQHVREYDVDIMNLQRASGLVPAGDDG
LVEIKLENGASLKSRSVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVTHVTLLEFDDKLRADEVLQKKLRSLGNVTIITSALTQEVLGDG
QKVNGLVYKDRVGGDAHRIELEGIFVQIGLLPNTEWLKDAVALSPRGEVVIDDRGQTSVP
GVFAAGDCTTVPYKQIIIAMGAGSTAALSAFDHLIRTTVPKSSGAVAEAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaacctccagtcccagctgaagacctacctggaacgcgtcacccggccg
atccagatcaccgcgcacgccgacgacggcgccaagtcgcaggagatgctagagctgctg
gaaaccctggtcagcctgtccagccagatcaccctcgacgtgcgccgcgacggcgccgag
cgcaccccctccttcgcgctgaccacgccgggccaggacatccacctggccttcgccggc
ctgccgatgggccacgaattcacctcgctggtgctggcgctgctgcaggtcggcggccac
ccctccaaggcaacggccgaggtgatcgagcaggtgcaggggttggaaggcgagtaccgg
ttcgagacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcactcaac
ctggcggcggtgctgaacccgcgcatccagcacgtggcgatcgacggtggcctgttcccg
gccgaggtcgaagcacgccagatcatgtccgtgcccaccgtgtacctcaacggtgaagtg
ttcgaccagggccgcatgagcctggagcagatcgtggccaagctggacaccggttcggcc
aagcgcgatgcggcgaagatcgccgcgaaggcgccgtacgacgtgctggtcatcggcggc
ggcccggccggcgccgctgcggcgatctacgccgcccgcaagggcatccgtaccggcgtc
gcagccgagcgtttcggtggccaggtgctggacaccatggcgatcgagaacttcatctcg
gtcaaggaaaccgaaggcccgaagctggccatggcgctggaacagcacgtgcgcgagtac
gacgtggacatcatgaacctgcagcgcgccagcggcctggtgccggccggcgacgatggc
ctggtcgagatcaagctggagaacggcgcatcgctgaagtcgcgctcggtgatcctgtcc
accggtgcgcgctggcgccagatgaacgtgcccggcgaagaccagtaccgcaacaagggt
gtggcctactgcccgcactgcgacggtccgttgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattccggggtggaagcggcgatcgacctggccggcatcgtgacgcatgtg
acccttctggagttcgacgacaaactgcgtgccgatgaagtcctgcagaagaagctgcgc
agcctgggcaatgtcaccatcatcaccagcgcgctcacccaggaagtgctgggcgatggt
caaaaggtgaacggcctggtctacaaggaccgcgtgggtggtgacgcccaccggatcgag
ctggaaggcatcttcgtgcagatcgggctgctgcccaatacggagtggctgaaggacgcg
gtggcgctgtcgccgcgcggcgaagtggtcattgacgaccgcggccagaccagtgttccg
ggcgtgttcgccgcgggagattgcacaaccgtaccctacaagcagatcatcatcgccatg
ggcgccggttcgacggccgcgctgagcgcttttgaccacctgatccgaactaccgttccc
aagagcagcggcgccgtcgccgaagctgcctga

DBGET integrated database retrieval system